SLC13A3/NaDC3 Antibody (3A6) - Azide and BSA Free

Western Blot: SLC13A3/NaDC3 Antibody (3A6) [H00064849-M02] - Detection against Immunogen (34.65 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3A6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC13A3/NaDC3 Antibody (3A6) - Azide and BSA Free Summary

• Immunogen: SLC13A3 (NP_073740, 152 a.a. ~ 232 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWK
• Specificity: SLC13A3 (3A6)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC13A3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC13A3/NaDC3 Antibody (3A6) - Azide and BSA Free

• hNaDC3
• Na(+)/dicarboxylate cotransporter 3
• NaDC3
• NaDC-3
• NADC3SDCT2naDC-3
• SDCT2
• SLC13A3
• sodium-dependent high affinity dicarboxylate transporter 3
• Sodium-dependent high-affinity dicarboxylate transporter 2
• solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3
• solute carrier family 13 member 3

Background

Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. The protein encoded by this gene represents the high-affinity form. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, although the full-length nature of some of them have not been characterized yet.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC13A3
• Entrez:
  • 64849(Human)
• OMIM:
  • 606411(Human)
• Uniprot:
  • NP_073740()