SIK1/Snf1lk Recombinant Protein Antigen

Images

 
There are currently no images for SIK1/Snf1lk Protein (NBP2-38397PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SIK1/Snf1lk Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SIK1.

Source: E.coli

Amino Acid Sequence: YLLLERLKEYRNAQCARPGPARQPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFPVDASCSGVF

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SIK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38397.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SIK1/Snf1lk Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • msk
  • myocardial SNF1-like kinase
  • salt-inducible kinase 1
  • Salt-inducible protein kinase 1
  • serine/threonine protein kinase
  • serine/threonine-protein kinase SIK1
  • Serine/threonine-protein kinase SNF1-like kinase 1
  • Serine/threonine-protein kinase SNF1LK
  • SIK
  • SIK-1
  • SNF1-like kinase
  • SNF1LKMSK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90364
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF3966
Species: Hu
Applications: WB, IHC
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA
AF2518
Species: Hu, Mu
Applications: WB, ICC
NBP2-80423
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-20237
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF189
Species: Hu, Mu
Applications: WB, IHC
NB100-56458
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB
NBP2-52555
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-38397PEP
Species: Hu
Applications: AC

Publications for SIK1/Snf1lk Protein (NBP2-38397PEP) (0)

There are no publications for SIK1/Snf1lk Protein (NBP2-38397PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIK1/Snf1lk Protein (NBP2-38397PEP) (0)

There are no reviews for SIK1/Snf1lk Protein (NBP2-38397PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SIK1/Snf1lk Protein (NBP2-38397PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional SIK1/Snf1lk Products

Bioinformatics Tool for SIK1/Snf1lk Protein (NBP2-38397PEP)

Discover related pathways, diseases and genes to SIK1/Snf1lk Protein (NBP2-38397PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIK1/Snf1lk Protein (NBP2-38397PEP)

Discover more about diseases related to SIK1/Snf1lk Protein (NBP2-38397PEP).
 

Pathways for SIK1/Snf1lk Protein (NBP2-38397PEP)

View related products by pathway.

PTMs for SIK1/Snf1lk Protein (NBP2-38397PEP)

Learn more about PTMs related to SIK1/Snf1lk Protein (NBP2-38397PEP).
 

Research Areas for SIK1/Snf1lk Protein (NBP2-38397PEP)

Find related products by research area.

Blogs on SIK1/Snf1lk

There are no specific blogs for SIK1/Snf1lk, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SIK1/Snf1lk Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SIK1