Signal sequence receptor delta Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 24-144 of human SSR4 (NP_006271.1). EACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNG |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SSR4 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:200-1:2000
|
Theoretical MW |
18 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Signal sequence receptor delta Antibody - BSA Free
Background
SSR4, also called TRAPD, is assumed to be involved in protein secretion. It is located in the Xq28 region, arranged in a compact head-to-head manner with the IDH3G gene. These two genes are driven by a bidirectional promoter located between them, and encode proteins involved in unrelated biochemical pathways located in different compartments of the cell. The nontranscribed intergenic region represents only 133 bp and is embedded in a CpG island. The CpG island functions as a bidirectional promoter to initiate the transcription of both functionally unrelated genes with distinct expression patterns. SSR4 consists of six exons and is approximately 70 kb telomeric to the ALD gene. Although alternative splicing of exon 5 has not been detected in human SSR4, transcript variants missing the region homologous to human exon 5 have been detected in both Xenopus laevis and Mus musculus.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ye
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Wf
Applications: EnzAct
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Publications for Signal sequence receptor delta Antibody (NBP2-93752) (0)
There are no publications for Signal sequence receptor delta Antibody (NBP2-93752).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Signal sequence receptor delta Antibody (NBP2-93752) (0)
There are no reviews for Signal sequence receptor delta Antibody (NBP2-93752).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Signal sequence receptor delta Antibody (NBP2-93752) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Signal sequence receptor delta Products
Research Areas for Signal sequence receptor delta Antibody (NBP2-93752)
Find related products by research area.
|
Blogs on Signal sequence receptor delta