SHIP2/INPPL1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SHIP2/INPPL1 Antibody [NBP1-87046] - Staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SHIP2/INPPL1 Antibody [NBP1-87046] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SHIP2/INPPL1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TLGELIGLYAQPNQGLVCALLLPVEGEREPDPPDDRDASDGEDEKPPLPPRSGSTSISAPTGPSSPLPAPETPTAPAAESAPNGLST
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INPPL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot Reported in scientific publication (PMID: 32535200)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SHIP2/INPPL1 Protein (NBP1-87046PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SHIP2/INPPL1 Antibody - BSA Free

• EC 3.1.3
• EC 3.1.3.n1
• inositol polyphosphate phosphatase-like 1
• Inositol polyphosphate phosphatase-like protein 1
• INPPL1
• INPPL-1
• phosphatidylinositol-34,5-trisphosphate 5-phosphatase 2
• Protein 51C
• SH2 domain-containing inositol phosphatase 2
• SH2 domain-containing inositol-5'-phosphatase 2
• SHIP2
• SHIP-2
• SHIP251C protein

Background

INPPL1 encodes inositol polyphosphate-5 phosphatase-like 1, a protein that in addition to the phosphatase domain contains an SH2 (src-homology domain 2) motif.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SHIP2/INPPL1 Antibody (NBP1-87046)(2)

Publications using NBP1-87046

• Antoine M, Vandenbroere I, Ghosh S et al. IRSp53 is a novel interactor of SHIP2: A role of the actin binding protein Mena in their cellular localization in breast cancer cells Cell. Signal. 2020-06-11 [PMID: 32535200] (ICC/IF, WB, Human)
• Mostafavi S, Gaiteri C, Sullivan SE et al. A molecular network of the aging human brain provides insights into the pathology and cognitive decline of Alzheimer's disease Nat. Neurosci. 2018-06-01 [PMID: 29802388] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: INPPL1