SHIP Recombinant Protein Antigen

Images

 
There are currently no images for SHIP Recombinant Protein Antigen (NBP2-49633PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SHIP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SHIP.

Source: E. coli

Amino Acid Sequence: MPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
INPP5D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49633.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SHIP Recombinant Protein Antigen

  • 145kD
  • EC 3.1.3
  • hp51CNMGC142142
  • Inositol polyphosphate-5-phosphatase of 145 kDa
  • inositol polyphosphate-5-phosphatase, 145kDa
  • INPP5D
  • MGC104855
  • SHIP
  • SHIPMGC142140

Background

SH2-containing inositol phosphatase 1 (SHIP) is a 145 kDa hemopoietic-specific phosphatase that hydrolyzes phosphatidylinositol-3,4,5-triphosphate to phosphatidylinositol-3, 4-bisphosphate. SHIP has been shown to bind directly a phosphorylated motif, immunoreceptor tyrosine-based inhibition motif (ITIM), present in the cytoplasmic domain of FcgammaRIIB1 (1). Also, results demonstrate that FcgammaRIIB use SHIP1 to inhibit pathways shared by receptor tyrosine kinases and immunoreceptors to trigger cell proliferation and cell activation, respectively (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003636-M01
Species: Hu, Pm
Applications: ELISA, ICC/IF, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-83276
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5129
Species: Hu
Applications: WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
AF3790
Species: Hu, Mu
Applications: ICC, Simple Western, WB
AF3846
Species: Hu, Mu, Rt
Applications: IHC, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-49633PEP
Species: Hu
Applications: AC

Publications for SHIP Recombinant Protein Antigen (NBP2-49633PEP) (0)

There are no publications for SHIP Recombinant Protein Antigen (NBP2-49633PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHIP Recombinant Protein Antigen (NBP2-49633PEP) (0)

There are no reviews for SHIP Recombinant Protein Antigen (NBP2-49633PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SHIP Recombinant Protein Antigen (NBP2-49633PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SHIP Products

Research Areas for SHIP Recombinant Protein Antigen (NBP2-49633PEP)

Find related products by research area.

Blogs on SHIP.

Getting SHIP-shape Over Tumour Suppression
PTEN antibodies have shown PTEN to be an important tumor suppressor and, in mutated form, a factor in cancer development. However, a recent study, led by Robert Rickert, shows that the SHIP gene may also be an important tumor suppressor in B-cell lymp...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SHIP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol INPP5D