Home » SH3GLB2 » SH3GLB2 Proteins » SH3GLB2 Recombinant Protein Antigen

SH3GLB2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SH3GLB2 Protein (NBP1-81368PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

SH3GLB2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SH3GLB2.

Source: E.coli

Amino Acid Sequence: HDFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLY
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SH3GLB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81368.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SH3GLB2 Recombinant Protein Antigen

  • endophilin-B2
  • GRB2-like, endophilin B2
  • SH3-containing protein SH3GLB2
  • SH3-domain GRB2-like endophilin B2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RhoA Antibody
NB100-91273
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
Immunohistochemistry-Paraffin: RhoA Antibody [NB100-91273] - IHC on rat brain (paraffin section) using Rabbit antibody to Transforming protein RhoA (Arha, Arha2): whole serum at 1 : 300 dilution incubated overnight at 4C and developed with ABC/DAB/Ni.
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
(1 Review)
(4 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Publications)
Species: Hu
Applications: BA
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
RAR beta/NR1B2
Antibody
NBP1-81776
Immunocytochemistry/Immunofluorescence: RAR beta/NR1B2 Antibody [NBP1-81776] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RAR beta/NR1B2 Antibody [NBP1-81776] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: RAR beta/NR1B2 Antibody [NBP1-81776] - Staining of human pancreas shows weak nuclear positivity in exocrine glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
RIG-I Antibody
AF4859
Western blot shows lysates of A172 human glioblastoma cell line and Nalm‑6 human Pre‑B acute lymphocytic leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human RIG-I Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4859) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for RIG-I at approximately 105 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
MAVS Antibody -
BSA Free
NB100-80859
Immunocytochemistry/Immunofluorescence: MAVS Antibody - BSA Free [NB100-80859] - Mouse Brain cells with VISA antibody at 20 ug/ml.
Western Blot: MAVS Antibody - BSA Free [NB100-80859] - Rat brain tissue lysate with VISA antibody at (A) 0.5, (B) 1 and (C) 2 ug/ml.
Immunohistochemistry-Paraffin: MAVS Antibody - BSA Free [NB100-80859] - Staining of human brain, cortex tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
(1 Review)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen: Tyrosine Hydroxylase Antibody [NB300-109] - 10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the mushroom body. All panels show a right brain hemisphere (dorsal to the top, medial to the right), except panels M-O (posterior to the top). Tyrosine hydroxylase (TH) immunoreactivity is shown in magenta (A, D, G, J, M) and synapsin immunoreactivity in green (B, E, H, K, N). Corresponding merged images in C, F, I, L, O. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
(7 Reviews)
(177 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(55 Publications)
Species: Hu
Applications: BA
UBL4A Antibody
(OTI1D4)
NBP2-03621
Western Blot: UBL4A Antibody (1D4) [NBP2-03621] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY UBL4A (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-UBL4A.
Immunohistochemistry-Paraffin: UBL4A Antibody (1D4) [NBP2-03621] - Staining of paraffin-embedded Human liver tissue using anti-UBL4A mouse monoclonal antibody.
Immunocytochemistry/Immunofluorescence: UBL4A Antibody (1D4) [NBP2-03621] Staining of COS7 cells transiently transfected by pCMV6-ENTRY UBL4A.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Filamin A Antibody
(4E10-1B2)
H00002316-M01
Western Blot: Filamin A Antibody (4E10-1B2) [H00002316-M01] - FLNA monoclonal antibody (M01), clone 4E10-1B2 Analysis of FLNA expression in HL-60.
ELISA: Filamin A Antibody (4E10-1B2) [H00002316-M01] - Filamin A Antibody (4E10-1B2) [H00002316-M01] - Detection limit for recombinant GST tagged FLNA is approximately 0.03ng/ml as a capture antibody.
Proximity Ligation Assay: Filamin A Antibody (4E10-1B2) [H00002316-M01] - Analysis of protein-protein interactions between GP1BA and FLNA. HeLa cells were stained with anti-GP1BA rabbit purified polyclonal 1:1200 and anti-FLNA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
(11 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
GAPDH Antibody
(1D4)
NB300-221
Western Blot: GAPDH Antibody (1D4) [NB300-221] - Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - Analysis of of HeLa cells stained with GAPDH antibody, dilution 1:100 (Green). DAPI staining of nuclear DNA (Blue). The GAPDHantibody produces strong cytoplasmic staining of healthy cells.
Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - SH-SY5Y cells stained with GAPDH antibody NB300-221 (green). Nuclear DNA is stained with Hoechst dye (blue).
(19 Reviews)
(366 Publications)
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western blot shows lysates of D3 mouse embryonic stem cell line, NTera‑2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
BG01V human embryonic stem cells were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. SOX2/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The nanog promoter was detected by standard PCR.
Simple Western lane view shows lysates of BG01V human embryonic stem cells and NTera‑2 human testicular embryonic carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for SOX2 at approximately 53 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(6 Reviews)
(179 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, Simple Western, WB
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Progesterone R/NR3C3 was detected in immersion fixed T47D human breast cancer cell line using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 1.7 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Progesterone R/NR3C3 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of T47D human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) followed by HRP‑conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for PR-A and PR-B at approximately 90 and 118 kDa, respectively (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Endophilin
A1/SH3GL2 Antibody (5
H00006456-M01
Immunohistochemistry-Paraffin: Endophilin A1/SH3GL2 Antibody (5A6) [H00006456-M01] - Analysis of monoclonal antibody to SH3GL2 on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 3 ug/ml.
Western Blot: Endophilin A1/SH3GL2 Antibody (5A6) [H00006456-M01] - SH3GL2 monoclonal antibody (M01), clone 5A6 Analysis of SH3GL2 expression in PC-12.
Sandwich ELISA: Endophilin A1/SH3GL2 Antibody (5A6) [H00006456-M01] - Detection limit for recombinant GST tagged SH3GL2 is approximately 0.1ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, IP, S-ELISA, WB
DREF Antibody
(OTI5A2) - Azide and ...
NBP2-71419
Western Blot: DREF Antibody (OTI5A2) - Azide and BSA Free [NBP2-71419] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DREF.
Flow Cytometry: DREF Antibody (OTI5A2) - Azide and BSA Free [NBP2-71419] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by DREF1 antibody.
Immunohistochemistry: DREF Antibody (OTI5A2) - Azide and BSA Free [NBP2-71419] - Analysis of Adenocarcinoma of Human colon tissue.
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(8 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(24 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Recombinant Human
TRAM1 GST (N-Term) Pr ...
H00023471-P01
SDS-Page: Recombinant Human TRAM1 Protein [H00023471-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Plexin A3 Antibody
[Unconjugated]
AF4075
Plexin A3 was detected in immersion fixed frozen sections of embryonic rat spinal cord using Goat Anti-Mouse Plexin A3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4075) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Plexin A3 was detected in immersion fixed frozen sections of mouse spinal cord using Goat Anti-Mouse Plexin A3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4075) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(2 Publications)
Species: Mu, Rt
Applications: IHC, WB
SH3GLB2
Recombinant Protein A
NBP1-81368PEP
SH3GLB2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SH3GLB2 Protein (NBP1-81368PEP) (0)

There are no publications for SH3GLB2 Protein (NBP1-81368PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3GLB2 Protein (NBP1-81368PEP) (0)

There are no reviews for SH3GLB2 Protein (NBP1-81368PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SH3GLB2 Protein (NBP1-81368PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SH3GLB2 Products

Bioinformatics Tool for SH3GLB2 Protein (NBP1-81368PEP)

Discover related pathways, diseases and genes to SH3GLB2 Protein (NBP1-81368PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3GLB2 Protein (NBP1-81368PEP)

Discover more about diseases related to SH3GLB2 Protein (NBP1-81368PEP).
 

Pathways for SH3GLB2 Protein (NBP1-81368PEP)

View related products by pathway.

PTMs for SH3GLB2 Protein (NBP1-81368PEP)

Learn more about PTMs related to SH3GLB2 Protein (NBP1-81368PEP).
 

Research Areas for SH3GLB2 Protein (NBP1-81368PEP)

Find related products by research area.

Blogs on SH3GLB2

There are no specific blogs for SH3GLB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: GAPDH Antibody (1D4) [NB300-221] - Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
GAPDH Antibody (1D4)
NB300-221
Immunohistochemistry-Frozen: Tyrosine Hydroxylase Antibody [NB300-109] - 10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Tyrosine Hydroxylase Antibody
NB300-109

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SH3GLB2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SH3GLB2