SH3GLB2 Recombinant Protein Antigen

Images

 
There are currently no images for SH3GLB2 Protein (NBP1-81368PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SH3GLB2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SH3GLB2.

Source: E.coli

Amino Acid Sequence: HDFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLY

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SH3GLB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81368.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SH3GLB2 Recombinant Protein Antigen

  • endophilin-B2
  • GRB2-like, endophilin B2
  • SH3-containing protein SH3GLB2
  • SH3-domain GRB2-like endophilin B2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-81776
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4859
Species: Hu
Applications: WB
NB100-80859
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
1129-ER
Species: Hu
Applications: BA
NBP2-03621
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002316-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, Simple Western, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
H00006456-M01
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, IP, S-ELISA, WB
NBP2-71419
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00023471-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF4075
Species: Mu, Rt
Applications: IHC, WB
NBP1-81368PEP
Species: Hu
Applications: AC

Publications for SH3GLB2 Protein (NBP1-81368PEP) (0)

There are no publications for SH3GLB2 Protein (NBP1-81368PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3GLB2 Protein (NBP1-81368PEP) (0)

There are no reviews for SH3GLB2 Protein (NBP1-81368PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SH3GLB2 Protein (NBP1-81368PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SH3GLB2 Products

Bioinformatics Tool for SH3GLB2 Protein (NBP1-81368PEP)

Discover related pathways, diseases and genes to SH3GLB2 Protein (NBP1-81368PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3GLB2 Protein (NBP1-81368PEP)

Discover more about diseases related to SH3GLB2 Protein (NBP1-81368PEP).
 

Pathways for SH3GLB2 Protein (NBP1-81368PEP)

View related products by pathway.

PTMs for SH3GLB2 Protein (NBP1-81368PEP)

Learn more about PTMs related to SH3GLB2 Protein (NBP1-81368PEP).
 

Research Areas for SH3GLB2 Protein (NBP1-81368PEP)

Find related products by research area.

Blogs on SH3GLB2

There are no specific blogs for SH3GLB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SH3GLB2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3GLB2