Recombinant Human SH3D19 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SH3D19 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 420 of Human SH3D19 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDLQKKQSNLATGLSKAKSQVFKNQDPVLPPRPKPGHPLYSKYMLSVPHGIANEDIVSQNPGELSCKRGDVLVMLKQTENNYLECQKGEDTGRVHLSQMKIITPLDEHLRSRPNDPSHAQKPVDSGAPHAVVLHDFPAEQVDDLNLTSGEIVYLLEKIDTDWYRGNCRNQIGIFPANYVKVIIDIPEGGNGKRECVSSHCVKGSRCVARFEYIGEQKDELSFSEGEIIILKEYVNEEWARGEVRGRTGIFPLNFVEPVEDYPTSGANVLSTKVPLKTKKEDSGSNSQVNSLPAEWCEALHSFTAETSDDLSFKRGDRIQILERLDSDWCRGRLQDREGIFPAVFVRPCPAEAKSMLAIVPKGRKAKALYDFRGENEDELSFKAGDIITELESVDDDWMSGELMGKSGIFPKNYIQFLQIS

Protein/Peptide Type
Recombinant Protein
Gene
SH3D19

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SH3D19 Protein

  • ADAM binding protein Eve-1
  • ADAM-binding protein Eve-1
  • DKFZp434D0215
  • EBPMGC118912
  • EEN binding protein
  • EEN-binding protein
  • EVE1
  • Kryn
  • MGC105136
  • MGC118910
  • MGC118911
  • MGC118913
  • SH3 domain containing 19
  • SH3 domain protein D19
  • SH3 domain-containing protein 19
  • SH3P19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC

Publications for SH3D19 Recombinant Protein (H00152503-P01) (0)

There are no publications for SH3D19 Recombinant Protein (H00152503-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3D19 Recombinant Protein (H00152503-P01) (0)

There are no reviews for SH3D19 Recombinant Protein (H00152503-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH3D19 Recombinant Protein (H00152503-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SH3D19 Products

Bioinformatics Tool for SH3D19 Recombinant Protein (H00152503-P01)

Discover related pathways, diseases and genes to SH3D19 Recombinant Protein (H00152503-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3D19 Recombinant Protein (H00152503-P01)

Discover more about diseases related to SH3D19 Recombinant Protein (H00152503-P01).
 

Pathways for SH3D19 Recombinant Protein (H00152503-P01)

View related products by pathway.

Blogs on SH3D19

There are no specific blogs for SH3D19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SH3D19 Antibody (5C7)
H00152503-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SH3D19 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3D19