Home » SH3D19 » SH3D19 Proteins » Recombinant Human SH3D19 Protein

Recombinant Human SH3D19 Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human SH3D19 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 420 of Human SH3D19 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDLQKKQSNLATGLSKAKSQVFKNQDPVLPPRPKPGHPLYSKYMLSVPHGIANEDIVSQNPGELSCKRGDVLVMLKQTENNYLECQKGEDTGRVHLSQMKIITPLDEHLRSRPNDPSHAQKPVDSGAPHAVVLHDFPAEQVDDLNLTSGEIVYLLEKIDTDWYRGNCRNQIGIFPANYVKVIIDIPEGGNGKRECVSSHCVKGSRCVARFEYIGEQKDELSFSEGEIIILKEYVNEEWARGEVRGRTGIFPLNFVEPVEDYPTSGANVLSTKVPLKTKKEDSGSNSQVNSLPAEWCEALHSFTAETSDDLSFKRGDRIQILERLDSDWCRGRLQDREGIFPAVFVRPCPAEAKSMLAIVPKGRKAKALYDFRGENEDELSFKAGDIITELESVDDDWMSGELMGKSGIFPKNYIQFLQIS
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SH3D19
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
73.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SH3D19 Protein

  • ADAM binding protein Eve-1
  • ADAM-binding protein Eve-1
  • DKFZp434D0215
  • EBPMGC118912
  • EEN binding protein
  • EEN-binding protein
  • EVE1
  • Kryn
  • MGC105136
  • MGC118910
  • MGC118911
  • MGC118913
  • SH3 domain containing 19
  • SH3 domain protein D19
  • SH3 domain-containing protein 19
  • SH3P19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Western blot analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Immunofluorescence analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: c-jun Antibody (5B1) [NBP2-37576] - Immunohistochemical analysis of paraffin-embedded human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
c-Fos Antibody
NB110-75039
Western Blot: c-Fos Antibody [NB110-75039] - Analysis on marmoset brain lysate prepared in Ripa buffer containing 1% Triton-X100; 1% SDS and 1% SDC. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution 1:2000incubated at 4C overnight.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody [NB110-75039] - Rat trigeminal using Rabbit antibody to cFos: whole serum at a 1:500 dilution.
Immunohistochemistry-Paraffin: c-Fos Antibody [NB110-75039] - IHC on rat brain (paraffin section) using Rabbit antibody to cFos (c-fos): whole serum at 1: 300 dilution incubated overnight at 4C and developed with ABC/DAB/Ni.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NFkB p50 (NLS)
Inhibitor Peptide Set
NBP2-29323
Functional (Inhibition): NFkB p105/p50 Inhibitor Peptide Set [NBP2-29323] - TLR5/NF-kB/SEAPorter HEK 293 (NBP2-26277) cells were plated in 96-well plates at 5 x 10^4 cells/well for 16 h. Cells were preincubated with different concentrations (0, 1, 5, 10, 25 and 50 uM) of Inhibitory Peptide (NBP2-29323) and Control Peptide (NBP2-29334) for 1 h. Cells were then stimulated with 1 ng/ml Flagellin (NBP2-25289) for 24 h. Secreted alkaline phosphatase (SEAP) was analyzed using SEAPorter Assay Kit (NBP2-25285). *p < 0.05 versus control peptide at the corresponding concentrations (Mann-Whitney U test).
(10 Publications)
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
GADD153/CHOP
Antibody (9C8)
NB600-1335
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - Ethanol feeding increases CHOP expression. Image from verified customer review.
Immunohistochemistry-Paraffin: GADD153/CHOP Antibody (9C8) [NB600-1335] - IHC analysis of a formalin fixed and paraffin embedded (FFPE) tissue section of mouse brain using 1:100 dilution of Calreticulin antibody. The signal was developed using HRP-DAB based detection method which followed counterstaining of the nuclei with hematoxylin. The antibody generated a cytoplasmic and nuclear staining of CHOP in various cell types in the tested section.
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - Western blot analysis of GADD153/CHOP expression in HeLa cells treated with 2.5ug/ml tunicamycin for 4 hours (Lane 1) and untreated (Lane 2).
(3 Reviews)
(20 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
FosB/G0S3 Antibody
(83B1138)
NB100-56530
Western Blot: FosB/G0S3 Antibody (83B1138) [NB100-56530] - Analysis of FosB in HeLa cell lysate where bands are observed ~38 kDa representing FosB and ~35 kDa representing delta FosB.
Species: Hu
Applications: WB
JunD [p Ser255]
Antibody (JJ08-21)
NBP2-67861
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Analysis of paraffin-embedded mouse liver tissue using anti-Phospho-JunD(S255) antibody. Counter stained with hematoxylin.
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
JunB/AP-1 Antibody
NBP1-89544
Western Blot: JunB/AP-1 Antibody [NBP1-89544] - Analysis in human cell lines MCF-7 and HEK293 using anti-JUNB antibody. Corresponding JUNB RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Immunocytochemistry/Immunofluorescence: JunB/AP-1 Antibody [NBP1-89544] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining in human fallopian tube and skeletal muscle tissues. Corresponding JUNB RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(495 Publications)
Species: Hu
CEBP Beta Antibody
(47A1)
NBP1-04266
Western Blot: CEBP Beta Antibody (47A1) [NBP1-04266] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1 hour at room temperature. The membrane was probed with anti-CEBP beta 1:1000 in non-fat milk. This image was submitted via customer review.
Western Blot: CEBP Beta Antibody (47A1) [NBP1-04266] - NIH 3T3 cell lysates were resolved by SDS-PAGE, transferred to PVDF membrane and probed with anti-human CEBP Beta; antibody (1:1,000). Protein was visualized using a goat anti-mouse secondary antibody conjugated to HRP and an ECL detection system.
(1 Review)
Species: Hu, Mu
Applications: WB, ELISA
PPAR gamma/NR1C3
Antibody
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
CREB [p Ser121]
Antibody
NB100-410
Western Blot: CREB [p Ser121] Antibody [NB100-410] - Detection of phospho-CREB in human HEK 293T cells. Top panel: probed with NB 100-410. Bottom panel: probed with CREB antibody. Lanes 2 and 4 treated with lambda phosphatase, lanes 3 and 4 treated with 0.2mM H202.
(8 Publications)
Species: Hu, Mu
Applications: WB, IP
SP1 Antibody
NB600-233
Western Blot: SP1 Antibody [NB600-233] - Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells.
Immunohistochemistry-Paraffin: SP1 Antibody [NB600-233] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-SP1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
Western Blot: SP1 Antibody [NB600-233] - Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse Renca cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SP1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
COCO/DAND5
Antibody (OTI2H3)
NBP2-01223
Western Blot: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DAND5 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DAND5.
Immunohistochemistry-Paraffin: DAND5 Antibody (2H3) [NBP2-01223] Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-DAND5 mouse monoclonal antibody.
Flow Cytometry: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DAND5 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Pan PSG Antibody
(684701) [Unconjugate ...
MAB6799
Western blot shows lysates of human placenta tissue. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human PSG Pan Specific Monoclonal Antibody (Catalog # MAB6799) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for PSG at approximately 72 and 64 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PSG was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human PSG Pan Specific Mono­clonal Antibody (Catalog # MAB6799) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cytotrophoblast cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC

Publications for SH3D19 Recombinant Protein (H00152503-P01) (0)

There are no publications for SH3D19 Recombinant Protein (H00152503-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3D19 Recombinant Protein (H00152503-P01) (0)

There are no reviews for SH3D19 Recombinant Protein (H00152503-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH3D19 Recombinant Protein (H00152503-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SH3D19 Products

Bioinformatics Tool for SH3D19 Recombinant Protein (H00152503-P01)

Discover related pathways, diseases and genes to SH3D19 Recombinant Protein (H00152503-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3D19 Recombinant Protein (H00152503-P01)

Discover more about diseases related to SH3D19 Recombinant Protein (H00152503-P01).
 

Pathways for SH3D19 Recombinant Protein (H00152503-P01)

View related products by pathway.

Blogs on SH3D19

There are no specific blogs for SH3D19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human SH3D19 Protein
H00152503-Q01-10ug
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: SH3D19 Antibody (5C7) [H00152503-M01] - SH3D19 monoclonal antibody (M01), clone 5C7 Analysis of SH3D19 expression in HeLa.
SH3D19 Antibody (5C7)
H00152503-M01
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - Ethanol feeding increases CHOP expression. Image from verified customer review.
GADD153/CHOP Antibody (9C8)
NB600-1335

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SH3D19 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SH3D19