SFRS14 Antibody - BSA Free

Staining of human cell line A-431 shows localization to nucleoplasm & nuclear bodies.

Western Blot: SFRS14 Antibody [NBP1-87868] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: SFRS14 Antibody [NBP1-87868] - Staining in human testis and pancreas tissues using anti-SUGP2 antibody. Corresponding SUGP2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SFRS14 Antibody [NBP1-87868] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: SFRS14 Antibody [NBP1-87868] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: SFRS14 Antibody [NBP1-87868] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-SUGP2 antibody NBP1-87868 (A) shows similar protein distribution across tissues to independent antibody NBP2-38906 (B).

Immunohistochemistry-Paraffin: SFRS14 Antibody [NBP1-87868] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: SFRS14 Antibody [NBP1-87868] - Staining of human kidney.

Immunohistochemistry-Paraffin: SFRS14 Antibody [NBP1-87868] - Staining of human lymph node.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SFRS14 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSLEYKYYKLKLAEMQRMSENLRGADQKPTSADCAVRAMLYSRAVRNLKKKLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SUGP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SFRS14 Protein (NBP1-87868PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SFRS14 Antibody - BSA Free

• Arginine/serine-rich-splicing factor 14
• DKFZp686M2322
• DKFZp779L2418
• KIAA0365arginine/serine-rich 14 splicing factor
• putative splicing factor, arginine/serine-rich 14
• SFRS14
• Splicing factor, arginine/serine-rich 14FLJ21855
• SRFS14
• SURP and G patch domain containing 2
• SURP and G-patch domain-containing protein 2

Background

SFRS14 (splicing factor arginine/serine-rich 14) is a putative alternative splicing factor. It contains two SURP motif repeats which are found among proteins involved in regulated mRNA splicing and a G-patch domain which features six highly conserved glycine residues found in several RNA-associated proteins. SFRS14 also bears an N-terminal arginine/serine-rich region found among the SR-related family of pre-mRNA processing factors. SFRS14 is also known as KIAA0365.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SUGP2