SFRS14 Antibody

Images

 
Western Blot: SFRS14 Antibody [NBP1-87868] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: SFRS14 Antibody [NBP1-87868] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: SFRS14 Antibody [NBP1-87868] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SFRS14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSLEYKYYKLKLAEMQRMSENLRGADQKPTSADCAVRAMLYSRAVRNLKKKLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUGP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SFRS14 Protein (NBP1-87868PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SFRS14 Antibody

  • Arginine/serine-rich-splicing factor 14
  • DKFZp686M2322
  • DKFZp779L2418
  • KIAA0365arginine/serine-rich 14 splicing factor
  • putative splicing factor, arginine/serine-rich 14
  • SFRS14
  • Splicing factor, arginine/serine-rich 14FLJ21855
  • SRFS14
  • SURP and G patch domain containing 2
  • SURP and G-patch domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1761
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-55245
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-71833
Species: Hu, Mu
Applications: WB
NBP1-88200
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-14998
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SFRS14 Antibody (NBP1-87868) (0)

There are no publications for SFRS14 Antibody (NBP1-87868).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFRS14 Antibody (NBP1-87868) (0)

There are no reviews for SFRS14 Antibody (NBP1-87868). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SFRS14 Antibody (NBP1-87868) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SFRS14 Products

Bioinformatics Tool for SFRS14 Antibody (NBP1-87868)

Discover related pathways, diseases and genes to SFRS14 Antibody (NBP1-87868). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SFRS14

There are no specific blogs for SFRS14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SFRS14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUGP2