Recombinant Human SFRS12IP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SFRS12IP1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 155 of Human P18SRP full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAVPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEKRINEEEEKKKEKSKEKIKLKKKRKRSYSSSSTEEDTSKQKKQKYQKKEKKKEKKSKSKKGKHHKKEKKKRKKEKHSSTPNSSEFSRK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SREK1IP1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SFRS12IP1 Protein

  • MGC131910
  • p18 splicing regulatory protein
  • p18SRP
  • P18SRPMGC150549
  • protein SFRS12IP1
  • protein SREK1IP1
  • SFRS12-interacting protein 1FLJ36754
  • SFRS12IP1
  • Splicing regulatory protein of 18 kDa
  • SREK1-interacting protein 1MGC150548

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-55755
Species: Hu
Applications: ICC/IF
NBP1-89014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
NBP2-58599
Species: Hu
Applications: ICC/IF
NBP1-77209
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IF
AF6387
Species: Hu
Applications: WB
NBP2-32706
Species: Hu
Applications: WB, IHC, IHC-P
AF6028
Species: Hu
Applications: WB, IHC
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
H00171023-M05
Species: Hu
Applications: WB, ELISA
H00026224-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for SFRS12IP1 Recombinant Protein (H00285672-P01) (0)

There are no publications for SFRS12IP1 Recombinant Protein (H00285672-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFRS12IP1 Recombinant Protein (H00285672-P01) (0)

There are no reviews for SFRS12IP1 Recombinant Protein (H00285672-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SFRS12IP1 Recombinant Protein (H00285672-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SFRS12IP1 Products

Bioinformatics Tool for SFRS12IP1 Recombinant Protein (H00285672-P01)

Discover related pathways, diseases and genes to SFRS12IP1 Recombinant Protein (H00285672-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SFRS12IP1

There are no specific blogs for SFRS12IP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SFRS12IP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SREK1IP1