SF3B4 Recombinant Protein Antigen

Images

 
There are currently no images for SF3B4 Recombinant Protein Antigen (NBP2-55882PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SF3B4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SF3B4.

Source: E. coli

Amino Acid Sequence: VSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SF3B4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55882.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SF3B4 Recombinant Protein Antigen

  • Hsh49
  • pre-mRNA splicing factor SF3b 49 kDa subunit
  • Pre-mRNA-splicing factor SF3b 49 kDa subunit
  • SAP 49
  • SAP49MGC10828
  • SF3b49
  • SF3b50
  • spliceosomal protein
  • spliceosome-associated protein (U2 snRNP)
  • Spliceosome-associated protein 49
  • splicing factor 3B subunit 4
  • splicing factor 3b, subunit 4, 49kD
  • splicing factor 3b, subunit 4, 49kDa

Background

The SF3B4 gene encodes one of four subunits of the splicing factor 3B. The protein encoded by this gene cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92380
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-53095
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-87430
Species: Hu
Applications: IHC,  IHC-P
NBP3-16440
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-57487
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16842
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP3-13841
Species: Hu
Applications: Flow, ICC/IF, PA
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00010907-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP1-84718
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1936
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
H00006607-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-55882PEP
Species: Hu
Applications: AC

Publications for SF3B4 Recombinant Protein Antigen (NBP2-55882PEP) (0)

There are no publications for SF3B4 Recombinant Protein Antigen (NBP2-55882PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF3B4 Recombinant Protein Antigen (NBP2-55882PEP) (0)

There are no reviews for SF3B4 Recombinant Protein Antigen (NBP2-55882PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SF3B4 Recombinant Protein Antigen (NBP2-55882PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SF3B4 Products

Array NBP2-55882PEP

Research Areas for SF3B4 Recombinant Protein Antigen (NBP2-55882PEP)

Find related products by research area.

Blogs on SF3B4

There are no specific blogs for SF3B4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SF3B4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3B4