Recombinant Human SF3B4 Protein Summary
Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 13-122 of Human SF3B4 Source: Wheat Germ Amino Acid Sequence: ATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSA |
Details of Functionality |
This protein is not active and should not be used for experiments requiring activity. |
Source |
Wheat germ |
Protein/Peptide Type |
Partial Recombinant Protein |
Gene |
SF3B4 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Application Notes |
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells. |
Theoretical MW |
37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human SF3B4 Protein
Background
This gene encodes one of four subunits of the splicing factor 3B. The protein encoded by this gene cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ELISA, PA, AP
Publications for SF3B4 Partial Recombinant Protein (H00010262-Q01) (0)
There are no publications for SF3B4 Partial Recombinant Protein (H00010262-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SF3B4 Partial Recombinant Protein (H00010262-Q01) (0)
There are no reviews for SF3B4 Partial Recombinant Protein (H00010262-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
- 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SF3B4 Partial Recombinant Protein (H00010262-Q01) (0)
Additional SF3B4 Products
Bioinformatics Tool for SF3B4 Partial Recombinant Protein (H00010262-Q01)
Discover related pathways, diseases and genes to SF3B4 Partial Recombinant Protein (H00010262-Q01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for SF3B4 Partial Recombinant Protein (H00010262-Q01)
Discover more about diseases related to SF3B4 Partial Recombinant Protein (H00010262-Q01).
| | Pathways for SF3B4 Partial Recombinant Protein (H00010262-Q01)
View related products by pathway.
|
PTMs for SF3B4 Partial Recombinant Protein (H00010262-Q01)
Learn more about PTMs related to SF3B4 Partial Recombinant Protein (H00010262-Q01).
|
Blogs on SF3B4