SF3B4 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

SF3B4 Partial Recombinant Protein Summary

Description
SF3B4 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: ATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSA
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
SF3B4

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SF3B4 Partial Recombinant Protein

  • Hsh49
  • pre-mRNA splicing factor SF3b 49 kDa subunit
  • Pre-mRNA-splicing factor SF3b 49 kDa subunit
  • SAP 49
  • SAP49MGC10828
  • SF3b49
  • SF3b50
  • spliceosomal protein
  • spliceosome-associated protein (U2 snRNP)
  • Spliceosome-associated protein 49
  • splicing factor 3B subunit 4
  • splicing factor 3b, subunit 4, 49kD
  • splicing factor 3b, subunit 4, 49kDa

Background

This gene encodes one of four subunits of the splicing factor 3B. The protein encoded by this gene cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-79847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-55256
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-53095
Species: Hu, Mu, Rt, Po, Bv, Mk, Rb, Sh, Ze
Applications: WB, ICC/IF, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22274
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-57455
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1077
Species: Hu
Applications: WB, ELISA, PEP-ELISA
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB110-89726
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-16035
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010907-M01
Species: Hu
Applications: WB, ELISA
NBP1-84718
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00010262-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SF3B4 Partial Recombinant Protein (H00010262-Q01) (0)

There are no publications for SF3B4 Partial Recombinant Protein (H00010262-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF3B4 Partial Recombinant Protein (H00010262-Q01) (0)

There are no reviews for SF3B4 Partial Recombinant Protein (H00010262-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SF3B4 Partial Recombinant Protein (H00010262-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SF3B4 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for SF3B4 Partial Recombinant Protein (H00010262-Q01)

Discover related pathways, diseases and genes to SF3B4 Partial Recombinant Protein (H00010262-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SF3B4 Partial Recombinant Protein (H00010262-Q01)

Discover more about diseases related to SF3B4 Partial Recombinant Protein (H00010262-Q01).
 

Pathways for SF3B4 Partial Recombinant Protein (H00010262-Q01)

View related products by pathway.

PTMs for SF3B4 Partial Recombinant Protein (H00010262-Q01)

Learn more about PTMs related to SF3B4 Partial Recombinant Protein (H00010262-Q01).

Blogs on SF3B4

There are no specific blogs for SF3B4, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SF3B4

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00010262-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

SF3B4 Recombinant Protein
H00010262-P01-10ug
p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106