SF3B14 Antibody

Images

 
Western Blot: SF3B14 Antibody [NBP1-87431] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: SF3B14 Antibody [NBP1-87431] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining in human breast and skeletal muscle tissues using NBP1-87431 antibody. Corresponding SF3B6 RNA-seq data are presented ...read more
Western Blot: SF3B14 Antibody [NBP1-87431] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Independent Antibodies: Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human breast, colon, skeletal muscle and testis using Anti-SF3B6 antibody NBP1-87431 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human colon shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SF3B14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SF3B6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SF3B14 Protein (NBP1-87431PEP)
Publications
Read Publication using NBP1-87431.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SF3B14 Antibody

  • HSPC175
  • Ht006
  • P14
  • pre-mRNA branch site protein p14
  • SAP14
  • SF3b 14 kDa subunit
  • SF3B14a
  • spliceosome-associated protein, 14 kDa subunit
  • splicing factor 3B, 14 kDa subunit

Background

The SF3B14 gene encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subu

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SF3B14 Antibody (NBP1-87431)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for SF3B14 Antibody (NBP1-87431) (0)

There are no reviews for SF3B14 Antibody (NBP1-87431). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SF3B14 Antibody (NBP1-87431) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SF3B14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3B6