Home » SF3B14 » SF3B14 Antibodies » SF3B14 Antibody

SF3B14 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: SF3B14 Antibody [NBP1-87431] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot: SF3B14 Antibody [NBP1-87431] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: SF3B14 Antibody [NBP1-87431] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining in human breast and skeletal muscle tissues using anti-SF3B6 antibody. Corresponding SF3B6 RNA-seq data are presented for the same tissues.
Western Blot: SF3B14 Antibody [NBP1-87431] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human breast shows high expression.
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SF3B14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPP
Specificity
Specificity of human, mouse, rat SF3B14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SF3B14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SF3B14 Protein (NBP1-87431PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SF3B14 Antibody

  • HSPC175
  • Ht006
  • P14
  • pre-mRNA branch site protein p14
  • SAP14
  • SF3b 14 kDa subunit
  • SF3B14a
  • spliceosome-associated protein, 14 kDa subunit
  • splicing factor 3B, 14 kDa subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p19ARF Antibody
NB200-106
Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - IHC analysis of formalin fixed paraffin-embedded (FFPE) mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(1 Review)
(40 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
p21/CIP1/CDKN1A
Antibody (WA-1 (HJ21)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(11 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Western Blot: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TCEAL1.
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)(
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC
D4S234E Antibody
(1C3)
H00027065-M01
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3 Analysis of D4S234E expression in IMR-32.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA
SLC10A7 Antibody
NBP1-86784
Immunohistochemistry: SLC10A7 Antibody [NBP1-86784] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: IHC, IHC-P
RRP4 Antibody
NBP1-92355
Western Blot: RRP4 Antibody [NBP1-92355] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: RRP4 Antibody [NBP1-92355] - Staining of human kidney shows strong positivity in tubules.
Western Blot: RRP4 Antibody [NBP1-92355] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
p15INK4b/CDKN2B
Antibody (OTI3B6)
NBP2-45603
Western Blot: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CDKN2B.
Immunohistochemistry: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of Adenocarcinoma of Human endometrium tissue.
Flow Cytometry: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by CDKN2B antibody.
Species: Hu
Applications: WB, Flow, IHC
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - analysis of EXOSC10 in HeLa whole cell extracts treated with (1) si-control and (2) EXOSC10 siRNA using anti-EXOSC10 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
SUB1 Antibody
NBP1-82454
Western Blot: SUB1 Antibody [NBP1-82454] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/Immunofluorescence: SUB1 Antibody [NBP1-82454] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human breast shows strong nuclear positivity in glandular cells.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MRPL28 Antibody
NBP1-82805
Western Blot: MRPL28 Antibody [NBP1-82805] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: MRPL28 Antibody [NBP1-82805] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: MRPL28 Antibody [NBP1-82805] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NXT1 Antibody
(4F11)
H00029107-M08
Western Blot: NXT1 Antibody (4F11) [H00029107-M08] - Analysis of NXT1 expression in transfected 293T cell line by NXT1 monoclonal antibody (M08), clone 4F11. Lane 1: NXT1 transfected lysatE (15.51 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: NXT1 Antibody (4F11) [H00029107-M08] - Analysis of monoclonal antibody to NXT1 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: NXT1 Antibody (4F11) [H00029107-M08] - Western blot analysis of NXT1 over-expressed 293 cell line, cotransfected with NXT1 Validated Chimera RNAi or non-transfected control. Blot probed with H00029107-M08. GAPDH (36.1 kDa) used as loading control.
Species: Hu
Applications: WB, ELISA, ICC/IF
S100A10 Antibody
[Unconjugated]
AF2377
Western blot shows lysates of mouse lung and MEF mouse embryonic feeder cells. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for S100A10 at approximately 11 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue and MEF mouse embryonic feeder cells, loaded at 0.2 mg/mL. A specific band was detected for S100A10 at approximately 11 kDa (as indicated) using 1 µg/mL of Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
S100A10 was detected in perfusion fixed frozen sections of mouse kidney using Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane in epithelial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(4 Publications)
Species: Mu
Applications: WB, Simple Western, IHC
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunocytochemistry/Immunofluorescence: PMEL17/SILV Antibody (10E5) [NBP1-47974] Staining of COS7 cells transiently transfected by pCMV6-ENTRY PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded prostate tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Perforin Antibody
(CB5.4)
NBP1-97512
Western Blot: Perforin Antibody (CB5.4) [NBP1-97512] - Detection of perforin in the mouse T cell clone B6.1. (lane 1). Absence of perforin in the mouse fibroblast cell line NIH.3T3 (lane 2). The protein migrates as a 66 kDa species. Method: Cell extracts from the T cell clone B6.1 (2x10^6) were resolved by SDS-PAGE under reducing conditions, transferred to nitrocellulose and probed with the CB5.4 antibody at 1 ug/ml. Proteins were visualized using a peroxidase-conjugated antibody to rat IgG and a chemiluminescence detection system.
(5 Publications)
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Recombinant Human
B3GALNT1 Protein
H00008706-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
NUCKS1 Antibody
NB100-74635
Western Blot: NUCKS1 Antibody [NB100-74635] - Detection of Human NUCKS by Western Blot of Immunoprecipitates. Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-NUCKS antibody NB100-74635 used for IP at 3 mcg/mg lysate. NUCKS was also immunoprecipitated by rabbit anti-NUCKS antibody NB100-74634, which recognizes an upstream epitope. Detection: Chemiluminescence with an exposure time of 30 seconds
Immunohistochemistry: NUCKS1 Antibody [NB100-74635] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- NUCKS used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Species: Hu
Applications: WB, IHC, IHC-P, IP
Protamine 1
Antibody
NBP2-30949
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining in human testis and endometrium tissues.. Corresponding PRM1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human endometrium shows no positivity in glandular cells as expected.
Species: Hu
Applications: IHC, IHC-P
RPLP1 Antibody
NBP1-81293
Western Blot: RPLP1 Antibody [NBP1-81293] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: RPLP1 Antibody [NBP1-81293] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
SF3B14 Antibody
NBP1-87431
SF3B14 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SF3B14 Antibody (NBP1-87431) (0)

There are no publications for SF3B14 Antibody (NBP1-87431).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF3B14 Antibody (NBP1-87431) (0)

There are no reviews for SF3B14 Antibody (NBP1-87431). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SF3B14 Antibody (NBP1-87431) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SF3B14 Antibody (NBP1-87431)

Discover related pathways, diseases and genes to SF3B14 Antibody (NBP1-87431). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SF3B14 Antibody (NBP1-87431)

Discover more about diseases related to SF3B14 Antibody (NBP1-87431).
 

Pathways for SF3B14 Antibody (NBP1-87431)

View related products by pathway.

Blogs on SF3B14

There are no specific blogs for SF3B14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SF3B14 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SF3B14