We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SETD1A Recombinant Protein Antigen

Images

 
There are currently no images for SETD1A Recombinant Protein Antigen (NBP2-49281PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SETD1A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SETD1A.

Source: E. coli

Amino Acid Sequence: SQFRSSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRPTDQDYRPPASEA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SETD1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49281.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SETD1A Recombinant Protein Antigen

  • histone-lysine N-methyltransferase SETD1A
  • hSET1A
  • KIAA0339EC 2.1.1.43
  • KMT2FSET1
  • Lysine N-methyltransferase 2F
  • SET domain containing 1A
  • SET domain-containing protein 1A
  • Set1
  • Set1/Ash2 histone methyltransferase complex subunit SET1
  • SET1A

Background

SET1A is a component of a histone methyltransferase (HMT) complex that produces mono-, di-, and trimethylated histone H3 at Lys4. The complex is the analog of the S. cerevisiae Set1/COMPASS complex (Lee and Skalnik, 2005 [PubMed 16253997]). Also see SET1B (MIM 611055).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP3-27690
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP3-03807
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NB600-250
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB600-252
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-67753
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF5810
Species: Hu, Mu
Applications: IHC, WB
NBP1-28684
Species: Hu
Applications: IHC,  IHC-P, IP
NBP2-57428
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
NB100-68209
Species: Hu
Applications: IP, KD, WB
NB100-1923
Species: Ce
Applications: IHC,  IHC-P, IP, WB
NB600-274
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB (-)
NBP2-94643
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NB100-2242
Species: Hu, Mu
Applications: ChIP, IP, WB
NB100-40845
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, KD, WB

Publications for SETD1A Recombinant Protein Antigen (NBP2-49281PEP) (0)

There are no publications for SETD1A Recombinant Protein Antigen (NBP2-49281PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SETD1A Recombinant Protein Antigen (NBP2-49281PEP) (0)

There are no reviews for SETD1A Recombinant Protein Antigen (NBP2-49281PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SETD1A Recombinant Protein Antigen (NBP2-49281PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SETD1A Products

Array NBP2-49281PEP

Research Areas for SETD1A Recombinant Protein Antigen (NBP2-49281PEP)

Find related products by research area.

Blogs on SETD1A

There are no specific blogs for SETD1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SETD1A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SETD1A