SETD1A Antibody

Immunocytochemistry/Immunofluorescence: SETD1A Antibody [NBP1-81513] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: SETD1A Antibody [NBP1-81513] - Staining of human Pancreas shows moderate nuclear positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: SETD1A Antibody [NBP1-81513] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: SETD1A Antibody [NBP1-81513] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: SETD1A Antibody [NBP1-81513] - Staining in human testis and pancreas tissues using anti-SETD1A antibody. Corresponding SETD1A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SETD1A Antibody [NBP1-81513] - Staining of human cerebral cortex, kidney, pancreas and testis using Anti-SETD1A antibody NBP1-81513 (A) shows similar protein distribution across tissues to independent antibody NBP2-49281 (B).

Immunohistochemistry-Paraffin: SETD1A Antibody [NBP1-81513] - Staining of human kidney.

Immunohistochemistry-Paraffin: SETD1A Antibody [NBP1-81513] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: SETD1A Antibody [NBP1-81513] - Staining of human Cerebral cortex shows moderate nuclear positivity in neuronal and glial cells.

Immunohistochemistry-Paraffin: SETD1A Antibody [NBP1-81513] - Staining of human cerebral cortex, kidney, pancreas and testis using Anti-SETD1A antibody NBP1-81513 (A) shows similar protein distribution across tissues to independent antibody NBP2-49281 (B).

Immunohistochemistry-Paraffin: SETD1A Antibody [NBP1-81513] - Staining of human Kidney shows moderate nuclear positivity in cells in tubules and glomeruli.

Immunohistochemistry-Paraffin: SETD1A Antibody [NBP1-81513] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Discontinued

SETD1A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AFGAFDQWWESKEEKAKPFQNAAKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKRKEPSEISEASEEKRPRPSTPAEEDEDDP
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SETD1A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SETD1A Antibody

• histone-lysine N-methyltransferase SETD1A
• hSET1A
• KIAA0339EC 2.1.1.43
• KMT2FSET1
• Lysine N-methyltransferase 2F
• SET domain containing 1A
• SET domain-containing protein 1A
• Set1
• Set1/Ash2 histone methyltransferase complex subunit SET1
• Set1A

Background

SET1A is a component of a histone methyltransferase (HMT) complex that produces mono-, di-, and trimethylated histone H3 at Lys4. The complex is the analog of the S. cerevisiae Set1/COMPASS complex (Lee and Skalnik, 2005 [PubMed 16253997]). Also see SET1B (MIM 611055).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SETD1A Antibody (NBP1-81513)(1)

Publication using NBP1-81513

• Cho HS, Shimazu T, Toyokawa G et al. Enhanced HSP70 lysine methylation promotes proliferation of cancer cells through activation of Aurora kinase B. Nat Commun 2012-01-01 [PMID: 22990868]

Bioinformatics

• Gene Symbol: SETD1A