Seryl tRNA synthetase Antibody (1H4) Summary
Immunogen |
SARS (AAH00716, 1 a.a. ~ 514 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA |
Specificity |
SARS - seryl-tRNA synthetase |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
SARS |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot
- Chromatin Immunoprecipitation
- ELISA
- Immunocytochemistry/Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Immunoprecipitation
- RNA Inhibition
|
Application Notes |
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Seryl tRNA synthetase Antibody (1H4)
Background
This gene belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Ze
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
Publications for Seryl tRNA synthetase Antibody (H00006301-M01)(4)
Showing Publications 1 -
4 of 4.
Reviews for Seryl tRNA synthetase Antibody (H00006301-M01) (0)
There are no reviews for Seryl tRNA synthetase Antibody (H00006301-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Seryl tRNA synthetase Antibody (H00006301-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional Seryl tRNA synthetase Products
Bioinformatics Tool for Seryl tRNA synthetase Antibody (H00006301-M01)
Discover related pathways, diseases and genes to Seryl tRNA synthetase Antibody (H00006301-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Seryl tRNA synthetase Antibody (H00006301-M01)
Discover more about diseases related to Seryl tRNA synthetase Antibody (H00006301-M01).
| | Pathways for Seryl tRNA synthetase Antibody (H00006301-M01)
View related products by pathway.
|
PTMs for Seryl tRNA synthetase Antibody (H00006301-M01)
Learn more about PTMs related to Seryl tRNA synthetase Antibody (H00006301-M01).
| | Research Areas for Seryl tRNA synthetase Antibody (H00006301-M01)
Find related products by research area.
|
Blogs on Seryl tRNA synthetase