Home » Seryl tRNA synthetase » Seryl tRNA synthetase Antibodies » Seryl tRNA synthetase Antibody (1H4)

Seryl tRNA synthetase Antibody (1H4)

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - SARS monoclonal antibody (M01), clone 1H4 Analysis of SARS expression in Jurkat.
Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - SARS monoclonal antibody (M01), clone 1H4 Analysis of SARS expression in Jurkat.
Immunocytochemistry/ Immunofluorescence: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on HeLa cell. Antibody concentration 25 ug/ml.
Immunohistochemistry-Paraffin: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on formalin-fixed paraffin-embedded human colon tissue. Antibody concentration 3 ug/ml.
Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of SARS over-expressed 293 cell line, cotransfected with SARS Validated Chimera RNAi ( Cat # H00006301-R01V ) (Lane 2) or non-transfected ...read more
Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of SARS expression in transfected 293T cell line by SARS monoclonal antibody (M01), clone 1H4.Lane 1: SARS transfected lysate(58.8 KDa).Lane ...read more
ELISA: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Detection limit for recombinant GST tagged SARS is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, ZeSpecies Glossary
Applications WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, KD
Clone
1H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Seryl tRNA synthetase Antibody (1H4) Summary

Immunogen
SARS (AAH00716, 1 a.a. ~ 514 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA
Specificity
SARS - seryl-tRNA synthetase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SARS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Knockdown Validated
  • Western Blot
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA.
Publications
Read Publications using H00006301-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Seryl tRNA synthetase Antibody (1H4)

  • EC 6.1.1.11
  • FLJ36399
  • serine-tRNA ligase
  • Serine--tRNA ligase
  • SERRS
  • SERSserine tRNA ligase 1, cytoplasmic
  • Seryl-tRNA Ser/Sec synthetase
  • seryl-tRNA synthetase
  • seryl-tRNA synthetase, cytoplasmic
  • Seryl-tRNA(Ser/Sec) synthetase

Background

This gene belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(18 Publications)
Species: Hu
Applications: BA
Afamin Antibody
NBP2-15304
Immunocytochemistry/Immunofluorescence: Afamin Antibody [NBP2-15304] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: Afamin Antibody [NBP2-15304] - Paraffin-embedded Cal27 xenograft, using antibody at 1:500 dilution.
Western Blot: Afamin Antibody [NBP2-15304] - Sample (30 ug of whole cell lysate) A: NIH-3T3 B: JC C: BCL-1 7. 5% SDS PAGE; antibody diluted at 1:5000.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SI
Sucrase-Isomaltase An
NBP1-87581
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Analysis in human small intestine and stomach tissues. Corresponding SI RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining of human small intestine shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining of human duodenum shows moderate to strong membranous positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
NOC2L Antibody
NBP1-92190
Immunocytochemistry/Immunofluorescence: NOC2L Antibody [NBP1-92190] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Western Blot: NOC2L Antibody [NBP1-92190] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunohistochemistry-Paraffin: NOC2L Antibody [NBP1-92190] - Staining of human cerebellum shows strong nucleolar positivity in Purkinje cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(3 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NK1R Antibody -
BSA Free
NB300-119
Western Blot: NK1R Antibody [NB300-119] - TACR1 and its downstream targets SRC and p-SRC are expressed in neuroblastoma cell lines. Endogenous TACR1 (NK1R), SRC and p-SRC expression in whole-cell extracts of neuroblastoma cell lines was visualized by western blotting. GAPDH was used as a loading control. Image collected and cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.13440), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: NK1R Antibody [NB300-119] - Neurokinin 1 Receptor Antibody [NB300-119] - Immunostain of NK1R in rat enteric glial cells. Image from verified customer review.
Immunohistochemistry: NK1R Antibody [NB300-119] - Neurokinin 1 Receptor Antibody [NB300-119] - Staining of human brain, basal nucleus of Meynert, neurons.
(2 Reviews)
(37 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
SPR Antibody
(OTI4F5)
NBP2-03256
Flow Cytometry: SPR Antibody (4F5) [NBP2-03256] - Analysis of Jurkat cells, using anti-SPR antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: SPR Antibody (4F5) [NBP2-03256] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-SPR antibody, and then analyzed by flow cytometry.
Western Blot: SPR Antibody (4F5) [NBP2-03256] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SPR (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SPR.
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Myoglobin Antibody
(SC06-38)
NBP2-67599
Immunocytochemistry/Immunofluorescence: Myoglobin Antibody (SC06-38) [NBP2-67599] - Staining Myoglobin in C2C12 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Myoglobin Antibody (SC06-38) [NBP2-67599] - Analysis of paraffin-embedded mouse heart tissue using anti-Myoglobin antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: Myoglobin Antibody (SC06-38) [NBP2-67599] - Analysis of paraffin-embedded mouse skeletal muscle tissue using anti-Myoglobin antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Phenylalanine
Hydroxylase Antibody
NBP2-48615
Western Blot: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Analysis using Anti-PAH antibody NBP2-48615 (A) shows similar pattern to independent antibody NBP1-80917 (B).
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Analysis in human liver and pancreas tissues. Corresponding Phenylalanine Hydroxylase RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Species: Hu
Applications: IHC, IHC-P, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Using the Alexa Fluor 488 direct conjugate, an intracellular stain was performed on HeLa cells with Cytochrome c (7H8.2C12) antibody NB100-56503AF488 (blue) and a matched isotype control NBP2-27231AF488 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): Cytochrome c Antibody (7H8.2C12) [NB100-56503] - An intracellular stain was performed on HeLa cells with Cytochrome c (7H8.2C12) antibody NB100-56503PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to phycoerythrin.
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Metformin activates apoptotic cell death; Right panel: MCF-7 cells were kept in the presence or absence of metformin for 20 days and then processed to obtain mitochondrial or whole cellular extracts. BAX and CYCS expression levels were determined by Western blot as indicated under Material and Methods. Densitometric analysis of the gels was performed as indicated under Material and Methods. PHB and CDK4 were used as purity and loading controls. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/2073-4409/8/1/49), licensed under a CC-BY licence.
(58 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
HARS Antibody
NBP1-89490
Immunocytochemistry/Immunofluorescence: HARS Antibody [NBP1-89490] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490] - Staining of human skin shows positivity in epidermal cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Kallikrein 3/PSA
[HRP]
DKK300
(16 Publications)
Species: Hu
Applications: ELISA
FLVCR Antibody
NB100-1481
Western Blot: FLVCR Antibody [NB100-1481] - (0.1ug/ml) staining of Human Bone Marrow lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Review)
(2 Publications)
Species: Hu
Applications: PEP-ELISA, WB
Lysozyme Antibody
- BSA Free
NBP2-61118
Simple Western: Lysozyme Antibody [NBP2-61118] - Lane view shows lysates of Ileum stem cells undifferentiated and day 5 differentiated, loaded at 0.2 mg/mL. A specific band was detected for Lysozyme at approximately 20 kDa (as indicated) using 20 ug/mL of Rabbit Anti-Lysozyme Polyclonal Antibody (NBP2-61118). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Flow Cytometry: Lysozyme Antibody [NBP2-61118] - An intracellular stain was performed on THP-1 Cells with NBP2-61118 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG APC-conjugated Secondary Antibody (R&D Systems, F0111).
Immunocytochemistry/Immunofluorescence: Lysozyme Antibody [NBP2-61118] - NIH3T3 cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-Lysozyme NBP2-61118 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(5 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
SAR1 Antibody
NBP2-20261
Western Blot: SAR1 Antibody [NBP2-20261] - Sample (30 ug of whole cell lysate) A: 293T B: A431 12% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SAR1 Antibody [NBP2-20261] - Immunofluorescence analysis of methanol-fixed A431, using antibody at 1:500 dilution.
(1 Publication)
Species: Hu
Applications: ICC/IF, WB
Recombinant Human
ZFYVE9 GST (N-Term) P ...
H00009372-P02
12.5% SDS-PAGE Stained with Coomassie Blue.
(1 Review)
Species: Hu
Applications: ELISA, AP, PA, WB
IL-17RD/SEF
Antibody
AF2275
IL‑17 RD/SEF was detected in immersion fixed paraffin-embedded sections of human kidney using 15 µg/mL Goat Anti-Human IL‑17 RD/SEF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2275) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of glomerulli and endothelial cells in capillaries in connective tissue. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
K562 human chronic myelogenous leukemia cell line was stained with Goat Anti-Human IL‑17 RD/SEF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2275, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
TFCP2 Antibody
H00007024-B01P
Western Blot: TFCP2 Antibody [H00007024-B01P] - Analysis of TFCP2 expression in PC-12.
Western Blot: TFCP2 Antibody [H00007024-B01P] - Analysis of TFCP2 expression in Hela S3 NE.
Western Blot: TFCP2 Antibody [H00007024-B01P] - Analysis of TFCP2 expression in transfected 293T cell line by TFCP2 polyclonal antibody. Lane 1: TFCP2 transfected lysate(55.22 KDa). Lane 2: Non-transfected lysate.
Species: Hu, Mu, Rt
Applications: WB
Seryl tRNA
synthetase Antibody (
H00006301-M01
Seryl tRNA synthetase Antibody (1H4)
Species: Hu, Mu, Ze
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, KD

Publications for Seryl tRNA synthetase Antibody (H00006301-M01)(4)


Reviews for Seryl tRNA synthetase Antibody (H00006301-M01) (0)

There are no reviews for Seryl tRNA synthetase Antibody (H00006301-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for Seryl tRNA synthetase Antibody (H00006301-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Seryl tRNA synthetase Products

Bioinformatics Tool for Seryl tRNA synthetase Antibody (H00006301-M01)

Discover related pathways, diseases and genes to Seryl tRNA synthetase Antibody (H00006301-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Seryl tRNA synthetase Antibody (H00006301-M01)

Discover more about diseases related to Seryl tRNA synthetase Antibody (H00006301-M01).
 

Pathways for Seryl tRNA synthetase Antibody (H00006301-M01)

View related products by pathway.

PTMs for Seryl tRNA synthetase Antibody (H00006301-M01)

Learn more about PTMs related to Seryl tRNA synthetase Antibody (H00006301-M01).
 

Research Areas for Seryl tRNA synthetase Antibody (H00006301-M01)

Find related products by research area.

Blogs on Seryl tRNA synthetase

There are no specific blogs for Seryl tRNA synthetase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Seryl tRNA synthetase Antibody (1H4) and receive a gift card or discount.


Bioinformatics

Gene Symbol SARS
Entrez
OMIM
Uniprot