Home » Seryl tRNA synthetase » Seryl tRNA synthetase Antibodies » Seryl tRNA synthetase Antibody (1H4)

Seryl tRNA synthetase Antibody (1H4)

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - SARS monoclonal antibody (M01), clone 1H4 Analysis of SARS expression in Jurkat.
Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - SARS monoclonal antibody (M01), clone 1H4 Analysis of SARS expression in Jurkat.
Immunocytochemistry/ Immunofluorescence: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on HeLa cell. Antibody concentration 25 ug/ml.
Immunohistochemistry-Paraffin: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on formalin-fixed paraffin-embedded human colon tissue. Antibody concentration 3 ug/ml.
Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of SARS over-expressed 293 cell line, cotransfected with SARS Validated Chimera RNAi ( Cat # H00006301-R01V ) (Lane 2) or non-transfected ...read more
Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of SARS expression in transfected 293T cell line by SARS monoclonal antibody (M01), clone 1H4.Lane 1: SARS transfected lysate(58.8 KDa).Lane ...read more
ELISA: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Detection limit for recombinant GST tagged SARS is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, RNAi
Clone
1H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Seryl tRNA synthetase Antibody (1H4) Summary

Immunogen
SARS (AAH00716, 1 a.a. - 514 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA
Specificity
SARS - seryl-tRNA synthetase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SARS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA.
Publications
Read Publications using H00006301-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Seryl tRNA synthetase Antibody (1H4)

  • EC 6.1.1.11
  • FLJ36399
  • serine-tRNA ligase
  • Serine--tRNA ligase
  • SERRS
  • SERSserine tRNA ligase 1, cytoplasmic
  • Seryl-tRNA Ser/Sec synthetase
  • seryl-tRNA synthetase
  • seryl-tRNA synthetase, cytoplasmic
  • Seryl-tRNA(Ser/Sec) synthetase

Background

This gene belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(12 Publications)
Species: Hu
Afamin Antibody
NBP2-15304
Western Blot: AFM Antibody [NBP2-15304] - Sample (30 ug of whole cell lysate) A: 293T B: A431 C: HeLa D: HepG2 7. 5% SDS PAGE; antibody diluted at 1:5000.
Immunocytochemistry/Immunofluorescence: AFM Antibody [NBP2-15304] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: Afamin Antibody [NBP2-15304] - Paraffin-embedded human colon. AFM antibody diluted at 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunocytochemistry/Immunofluorescence: PMEL17/SILV Antibody (10E5) [NBP1-47974] Staining of COS7 cells transiently transfected by pCMV6-ENTRY PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded prostate tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
SI
Sucrase-Isomaltase An
NBP1-87581
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining in human duodenum and liver tissues using anti-SI antibody. Corresponding SI RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
NOC2L Antibody
NBP1-92190
Western Blot: NOC2L Antibody [NBP1-92190] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/Immunofluorescence: NOC2L Antibody [NBP1-92190] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Immunohistochemistry-Paraffin: NOC2L Antibody [NBP1-92190] - Staining of human cerebellum shows strong nucleolar positivity in Purkinje cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
(38 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NK1R Antibody
NB300-119
Western Blot: NK1R Antibody [NB300-119] - Total protein from human, mouse and rat brain was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NK1R in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Neurokinin 1 Receptor Antibody [NB300-119] - Immunostain of NK1R in rat enteric glial cells. Image courtesy of anonymous customer review.
Immunohistochemistry: NK1R Antibody [NB300-119] - Neurokinin 1 Receptor Antibody [NB300-119] - Staining of human brain, basal nucleus of Meynert, neurons.
(2 Reviews)
(30 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
SPR Antibody
(OTI4F5)
NBP2-03256
Western Blot: SPR Antibody (4F5) [NBP2-03256] Analysis of extracts (35ug) from 9 different cell lines by using anti-SPR monoclonal antibody.
Immunocytochemistry/Immunofluorescence: SPR Antibody (4F5) [NBP2-03256] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY SPR.
Immunohistochemistry-Paraffin: SPR Antibody (4F5) [NBP2-03256] - Staining of paraffin-embedded Human pancreas tissue using anti-SPR mouse monoclonal antibody.
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Myoglobin Antibody
(SC06-38)
NBP2-67599
Western Blot: Myoglobin Antibody (SC06-38) [NBP2-67599] - Analysis of Myoglobin on human skeletal muscle lysates using anti-Myoglobin antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Myoglobin Antibody (SC06-38) [NBP2-67599] - Staining Myoglobin in C2C12 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Myoglobin Antibody (SC06-38) [NBP2-67599] - Analysis of paraffin-embedded mouse skeletal muscle tissue using anti-Myoglobin antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Phenylalanine
Hydroxylase Antibody
NBP1-52084
Western Blot: Phenylalanine Hydroxylase Antibody [NBP1-52084] - (0.1ug/ml) staining of Mouse (A) and Rat (B) Liver lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-52084] - Staining of paraffin embedded Human Kidney. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: Phenylalanine Hydroxylase Antibody [NBP1-52084] - Analysis of Phenylalanine Hydroxylase Human Liver lysate (35ug protein in RIPA buffer) using this antibody at 0.3 ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
Cytochrome c
Antibody (7H8.2C12)
NB100-56503
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Analysis using the Biotin conjugate of NB100-56503. Detection of Cytochrome C in 15 mgs of HeLa cell lysate using NB100-55775 at 1:1000. A 15 kDa band is detected.
Immunocytochemistry/Immunofluorescence: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - p73 was detected in immersion fixed Hela human cell line using Cytochrome C [7H8.2C12] Monoclonal Antibody (Catalog # NB100-56503) at 25 ug/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Staining was observed in the cytoplasm and mitochondria.
Immunohistochemistry-Paraffin: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Cytochrome C was detected in immersion fixed paraffin-embedded sections of human heart using anti-human mouse monoclonal antibody (Catalog # NB100-56503) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(47 Publications)
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
HARS Antibody
NBP1-89490
Western Blot: HARS Antibody [NBP1-89490] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/Immunofluorescence: HARS Antibody [NBP1-89490] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490] - Staining of human kidney shows positivity in cells in tubules.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
FLVCR Antibody
NB100-1481
Western Blot: FLVCR Antibody [NB100-1481] - (0.1ug/ml) staining of Human Bone Marrow lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, PEP-ELISA
Lysozyme Antibody
NBP2-61118
Western Blot: Lysozyme Antibody [NBP2-61118] - Total protein from human cell lines THP-1 and HepG2, human stomach and kidney as well as mouse kidney was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-Lysozyme in 5% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Lysozyme Antibody [NBP2-61118] - HeLa cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-Lysozyme at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Lysozyme Antibody [NBP2-61118] - IHC analysis of a formalin-fixed paraffin-embedded (FFPE) tissue section of human kidney with Lysozyme antibody at 1:100 dilution. The staining was developed with HRP-DAB detection method and the counterstaining was performed using hematoxylin. This Lysozyme antibody generated an expected cytoplasmic staining in all the cells with strongest signal in tubular epithelial cells. Some tubules showed more of a punctate staining pattern (vesicular Lysozyme) while all of the tubules depicted a diffused signal (secreted Lysozyme). A subset of cells, especially those from glomeruli, showed nuclear positivity also.
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
SAR1 Antibody
NBP2-20261
Western Blot: SAR1 Antibody [NBP2-20261] - Sample (30 ug of whole cell lysate) A: 293T B: A431 12% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SAR1 Antibody [NBP2-20261] - Immunofluorescence analysis of methanol-fixed A431, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, ICC/IF
ZFYVE9 Antibody
NBP2-57521
Immunocytochemistry/Immunofluorescence: ZFYVE9 Antibody [NBP2-57521] - Staining of human cell line RT4 shows localization to cytosol & vesicles.
Species: Hu
Applications: ICC/IF
IL-17 RD/SEF
Antibody
AF2275
IL‑17 RD/SEF was detected in immersion fixed paraffin-embedded sections of human kidney using 15 µg/mL Goat Anti-Human IL‑17 RD/SEF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2275) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of glomerulli and endothelial cells in capillaries in connective tissue. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
K562 human chronic myelogenous leukemia cell line was stained with Goat Anti-Human IL‑17 RD/SEF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2275, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
TFCP2 Antibody
H00007024-B01P
Western Blot: TFCP2 Antibody [H00007024-B01P] - Analysis of TFCP2 expression in NIH/3T3.
Western Blot: TFCP2 Antibody [H00007024-B01P] - Analysis of TFCP2 expression in PC-12.
Western Blot: TFCP2 Antibody [H00007024-B01P] - Analysis of TFCP2 expression in Hela S3 NE.
Species: Hu, Mu, Rt
Applications: WB

Publications for Seryl tRNA synthetase Antibody (H00006301-M01)(4)


Reviews for Seryl tRNA synthetase Antibody (H00006301-M01) (0)

There are no reviews for Seryl tRNA synthetase Antibody (H00006301-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Seryl tRNA synthetase Antibody (H00006301-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Seryl tRNA synthetase Antibody (H00006301-M01)

Discover related pathways, diseases and genes to Seryl tRNA synthetase Antibody (H00006301-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Seryl tRNA synthetase Antibody (H00006301-M01)

Discover more about diseases related to Seryl tRNA synthetase Antibody (H00006301-M01).
 

Pathways for Seryl tRNA synthetase Antibody (H00006301-M01)

View related products by pathway.

PTMs for Seryl tRNA synthetase Antibody (H00006301-M01)

Learn more about PTMs related to Seryl tRNA synthetase Antibody (H00006301-M01).
 

Research Areas for Seryl tRNA synthetase Antibody (H00006301-M01)

Find related products by research area.

Blogs on Seryl tRNA synthetase

There are no specific blogs for Seryl tRNA synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Seryl tRNA synthetase Antibody (1H4) and receive a gift card or discount.


Bioinformatics

Gene Symbol SARS
Entrez
OMIM
Uniprot