Seryl tRNA synthetase Antibody (1H4)

Images

 
Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - SARS monoclonal antibody (M01), clone 1H4 Analysis of SARS expression in Jurkat.
Immunocytochemistry/ Immunofluorescence: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on HeLa cell. Antibody concentration 25 ug/ml.
Immunohistochemistry-Paraffin: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on formalin-fixed paraffin-embedded human colon tissue. Antibody concentration 3 ug/ml.
Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of SARS over-expressed 293 cell line, cotransfected with SARS Validated Chimera RNAi ( Cat # H00006301-R01V ) (Lane 2) or non-transfected ...read more
Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of SARS expression in transfected 293T cell line by SARS monoclonal antibody (M01), clone 1H4.Lane 1: SARS transfected lysate(58.8 KDa).Lane ...read more
ELISA: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Detection limit for recombinant GST tagged SARS is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, RNAi
Clone
1H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Seryl tRNA synthetase Antibody (1H4) Summary

Immunogen
SARS (AAH00716, 1 a.a. - 514 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA
Specificity
SARS - seryl-tRNA synthetase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SARS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA.
Publications
Read Publications using H00006301-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Seryl tRNA synthetase Antibody (1H4)

  • EC 6.1.1.11
  • FLJ36399
  • serine-tRNA ligase
  • Serine--tRNA ligase
  • SerRS
  • SERSserine tRNA ligase 1, cytoplasmic
  • Seryl-tRNA Ser/Sec synthetase
  • seryl-tRNA synthetase
  • seryl-tRNA synthetase, cytoplasmic
  • Seryl-tRNA(Ser/Sec) synthetase

Background

This gene belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89156
Species: Hu
Applications: IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33546
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1481
Species: Hu
Applications: WB, PEP-ELISA
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-57521
Species: Hu
Applications: ICC/IF
AF2275
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
H00007024-B01P
Species: Hu, Mu, Rt
Applications: WB

Publications for Seryl tRNA synthetase Antibody (H00006301-M01)(4)

Reviews for Seryl tRNA synthetase Antibody (H00006301-M01) (0)

There are no reviews for Seryl tRNA synthetase Antibody (H00006301-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Seryl tRNA synthetase Antibody (H00006301-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Seryl tRNA synthetase Antibody (H00006301-M01)

Discover related pathways, diseases and genes to Seryl tRNA synthetase Antibody (H00006301-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Seryl tRNA synthetase Antibody (H00006301-M01)

Discover more about diseases related to Seryl tRNA synthetase Antibody (H00006301-M01).
 

Pathways for Seryl tRNA synthetase Antibody (H00006301-M01)

View related products by pathway.

PTMs for Seryl tRNA synthetase Antibody (H00006301-M01)

Learn more about PTMs related to Seryl tRNA synthetase Antibody (H00006301-M01).
 

Research Areas for Seryl tRNA synthetase Antibody (H00006301-M01)

Find related products by research area.

Blogs on Seryl tRNA synthetase

There are no specific blogs for Seryl tRNA synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Seryl tRNA synthetase Antibody (1H4) and receive a gift card or discount.

Bioinformatics

Gene Symbol SARS
Entrez
OMIM
Uniprot