SERPINB13 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SERPINB13 Antibody [NBP2-57225] - Staining of human cell line HaCaT shows localization to nuclear speckles & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SERPINB13 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RGATASQLEEVFHSEKETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SERPINB13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SERPINB13 Recombinant Protein Antigen (NBP2-57225PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SERPINB13 Antibody - BSA Free

• HaCaT UV-repressible serpin
• headpin
• HSHUR7SEQ
• HUR7
• HURPIN
• MGC126870
• Peptidase inhibitor 13
• PI-13
• PI13hurpin
• protease inhibitor 13 (hurpin, headpin)
• Proteinase inhibitor 13
• serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 13
• serpin B13
• serpin peptidase inhibitor, clade B (ovalbumin), member 13
• UV-B repressed sequence, HUR 7

Background

SERPINB13 may play a role in the proliferation or differentiation of keratinocytes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SERPINB13