SERPINB10 Antibody - BSA Free

Western Blot: SERPINB10 Antibody [NBP2-88243] - Host: Rabbit. Target Name: SERPINB10. Sample Tissue: Human COLO205 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

SERPINB10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SERPINB10 Antibody - BSA Free (NBP2-88243) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINB10. Peptide sequence: SDFQTLISEILKPNDDYLLKTANAIYGEKTYAFHNKYLEDMKTYFGAEPQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SERPINB10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SERPINB10 Antibody - BSA Free

• bomapin
• Peptidase inhibitor 10
• PI-10
• PI10protease inhibitor 10 (ovalbumin type, bomapin)
• serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 10
• serpin B10
• serpin peptidase inhibitor, clade B (ovalbumin), member 10

Background

Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SERPINB10