SERPINB10 Antibody

Images

 
Western Blot: SERPINB10 Antibody [NBP2-88243] - Host: Rabbit. Target Name: SERPINB10. Sample Tissue: Human COLO205 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SERPINB10 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SERPINB10. Peptide sequence: SDFQTLISEILKPNDDYLLKTANAIYGEKTYAFHNKYLEDMKTYFGAEPQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINB10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SERPINB10 Antibody

  • bomapin
  • Peptidase inhibitor 10
  • PI-10
  • PI10protease inhibitor 10 (ovalbumin type, bomapin)
  • serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 10
  • serpin B10
  • serpin peptidase inhibitor, clade B (ovalbumin), member 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8550
Species: Hu
Applications: CyTOF-ready, Flow, ICC, KO, WB
MAB4158
Species: Hu
Applications: IHC
NBP1-87780
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-03595
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45788
Species: Ce, Hu
Applications: IHC, IHC-P, WB
NBP2-03828
Species: Ca, Hu, Pm, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-93879
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB600-922
Species: Ch
Applications: ELISA, IHC, IHC-P, IP, Single-Cell Western, WB
NBP2-01650
Species: Hu, Pm, Mu
Applications: Flow, IHC, IHC-P, WB
NBP1-82782
Species: Hu
Applications: IHC, IHC-P
NBP2-30572
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-500
Species: Ec
Applications: ELISA, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP2-92789
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB9167
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
AF2769
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP3-05514
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SERPINB10 Antibody (NBP2-88243) (0)

There are no publications for SERPINB10 Antibody (NBP2-88243).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SERPINB10 Antibody (NBP2-88243) (0)

There are no reviews for SERPINB10 Antibody (NBP2-88243). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SERPINB10 Antibody (NBP2-88243) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SERPINB10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINB10