Serpin I1/Neuroserpin Antibody (1D10)

Images

 
Western Blot: Serpin I1/Neuroserpin Antibody (1D10) [H00005274-M01] - SERPINI1 monoclonal antibody (M01), clone 1D10 Analysis of SERPINI1 expression in HeLa.
Immunohistochemistry-Paraffin: Serpin I1/Neuroserpin Antibody (1D10) [H00005274-M01] - Analysis of monoclonal antibody to SERPINI1 on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 3 ...read more
Sandwich ELISA: Serpin I1/Neuroserpin Antibody (1D10) [H00005274-M01] - Detection limit for recombinant GST tagged SERPINI1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
1D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Serpin I1/Neuroserpin Antibody (1D10) Summary

Immunogen
SERPINI1 (AAH18043, 17 a.a. ~ 410 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQEEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLYDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
Specificity
SERPINI1 - serpin peptidase inhibitor, clade I (neuroserpin), member 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SERPINI1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publication using H00005274-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Serpin I1/Neuroserpin Antibody (1D10)

  • DKFZp781N13156
  • Neuroserpin
  • Peptidase inhibitor 12
  • PI12
  • PI-12
  • PI12Serpin I1
  • serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 1
  • Serpin I1
  • serpin peptidase inhibitor, clade I (neuroserpin), member 1

Background

This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67279
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-930
Species: Hu, Rt
Applications: WB, ELISA
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-93525
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-33188
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-517
Species: Hu
Applications: WB, ICC/IF, IP
NB100-56681
Species: Hu, Mu, Rt, Rb, Sh
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-97677
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-36963
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-93073
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005274-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for Serpin I1/Neuroserpin Antibody (H00005274-M01)(1)

Reviews for Serpin I1/Neuroserpin Antibody (H00005274-M01) (0)

There are no reviews for Serpin I1/Neuroserpin Antibody (H00005274-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serpin I1/Neuroserpin Antibody (H00005274-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Serpin I1/Neuroserpin Products

Bioinformatics Tool for Serpin I1/Neuroserpin Antibody (H00005274-M01)

Discover related pathways, diseases and genes to Serpin I1/Neuroserpin Antibody (H00005274-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin I1/Neuroserpin Antibody (H00005274-M01)

Discover more about diseases related to Serpin I1/Neuroserpin Antibody (H00005274-M01).
 

Pathways for Serpin I1/Neuroserpin Antibody (H00005274-M01)

View related products by pathway.

Blogs on Serpin I1/Neuroserpin

There are no specific blogs for Serpin I1/Neuroserpin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin I1/Neuroserpin Antibody (1D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINI1
Entrez
OMIM
Uniprot