SERCA3 ATPase Recombinant Protein Antigen

Images

 
There are currently no images for SERCA3 ATPase Protein (NBP1-87054PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SERCA3 ATPase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP2A3.

Source: E. coli

Amino Acid Sequence: SRDRKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP2A3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87054.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SERCA3 ATPase Recombinant Protein Antigen

  • adenosine triphosphatase, calcium
  • ATP2A3
  • ATPase, Ca(2+)-transporting, ubiquitous
  • ATPase, Ca++ transporting, ubiquitous
  • Calcium pump 3
  • EC 3.6.3
  • EC 3.6.3.8
  • sarco/endoplasmic reticulum Ca2+ ATPase
  • sarco/endoplasmic reticulum Ca2+ -ATPase
  • sarcoplasmic/endoplasmic reticulum calcium ATPase 3
  • SERCA3 ATPase
  • SERCA3
  • SERCA3calcium-translocating P-type ATPase
  • SR Ca(2+)-ATPase 3

Background

SERCA3 ATPase encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-581
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00000487-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-19807
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-3529
Species: Hu, Po, Rt
Applications: ELISA, IHC, IHC-Fr,  IHC-P, WB
NB300-569
Species: Am, Bv, Hu, Mu, Po, Rb, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD, WB
MAB8306
Species: Hu
Applications: IHC, WB
NBP3-47382
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-38962
Species: Hu
Applications: IHC,  IHC-P
NBP2-46376
Species: Hu
Applications: IHC,  IHC-P, WB
NB300-578
Species: Am, Ca, Ch, Fe, Ha, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
MAB5745
Species: Hu
Applications: IHC, WB
NBP1-86125
Species: Hu
Applications: IHC,  IHC-P
NBP3-25535
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-19083
Species: Hu
Applications: ICC/IF, WB
NB600-233
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
NBP2-80143
Species: Am, Bv, Ca, Ch, Fi, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for SERCA3 ATPase Protein (NBP1-87054PEP) (0)

There are no publications for SERCA3 ATPase Protein (NBP1-87054PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SERCA3 ATPase Protein (NBP1-87054PEP) (0)

There are no reviews for SERCA3 ATPase Protein (NBP1-87054PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SERCA3 ATPase Protein (NBP1-87054PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SERCA3 ATPase Products

Blogs on SERCA3 ATPase.

Mending a Broken Heart: New SERCA2 Gene Therapy Fights Heart Disease
While many of the proteins on our antibody database are studied in relation to their expression in diseases; others become therapies in their own right. This is the case with SERCA2 (Sarcoplasmic reticulum Calcium-ATPase 2 pump), which recently hit th...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SERCA3 ATPase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP2A3