| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 4B8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | ATP2A1 (NP_775293, 522 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ |
| Specificity | ATP2A1 - ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 |
| Isotype | IgG3 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ATP2A1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SERCA1 ATPase Antibody (H00000487-M05)Find related products by research area.
|
|
Mending a Broken Heart: New SERCA2 Gene Therapy Fights Heart Disease While many of the proteins on our antibody database are studied in relation to their expression in diseases; others become therapies in their own right. This is the case with SERCA2 (Sarcoplasmic reticulum Calcium-ATPase 2 pump), which recently hit th... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.