SERCA1 ATPase Antibody (4B8)

Immunohistochemistry-Paraffin: SERCA1 ATPase Antibody (4B8) [H00000487-M05] - Analysis of monoclonal antibody to ATP2A1 on formalin-fixed paraffin-embedded human skeletal muscle. Antibody concentration 3 ug/ml

• Reactivity: Hu
• Applications: WB, ELISA, IHC, IHC-P
• Clone: 4B8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

SERCA1 ATPase Antibody (4B8) Summary

• Immunogen: ATP2A1 (NP_775293, 522 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
• Specificity: ATP2A1 - ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
• Isotype: IgG3 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATP2A1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SERCA1 ATPase Antibody (4B8)

• ATP2A
• ATP2A1
• ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
• Calcium pump 1
• Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletalmuscle isoform
• EC 3.6.3
• EC 7.2.2.10
• Endoplasmic reticulum class 1/2 Ca(2+) ATPase
• sarcoplasmic/endoplasmic reticulum calcium ATPase 1
• SERCA1 ATPase
• SERCA1
• SERCA1EC 3.6.3.8
• SR Ca(2+)-ATPase 1

Background

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP2A1
• Entrez:
  • 487(Human)
• OMIM:
  • 108730(Human)
• Uniprot:
  • NP_775293(Human)