Septin-9 Antibody (2C6)

Images

 
ELISA: Septin-9 Antibody (2C6) [H00010801-M01] - Detection limit for recombinant GST tagged SEPT9 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
2C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Septin-9 Antibody (2C6) Summary

Immunogen
SEPT9 (AAH21192, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRRVQTPLLRATVASSTQKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTP
Specificity
SEPT9 - septin 9 (2C6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SEPT9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Immunocytochemistry/Immunofluorescence was reported in scientific literature.
Publications
Read Publications using
H00010801-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Septin-9 Antibody (2C6)

  • AF17q25
  • FLJ75490
  • KIAA0991Ov/Br septin
  • MLL septin-like fusion protein MSF-A
  • MLL septin-like fusion protein
  • MSF1NAPB
  • MSFMLL septin-like fusion
  • Ovarian/Breast septin
  • PNUTL4
  • SeptD1
  • septin 9
  • Septin D1
  • septin-9
  • SINT1

Background

Septin-9 is a member of the septin family, which contains cytoplasmic cytoskeletal filament-forming proteins that have a conserved GTP-binding domain (Osaka et al., 1999 [PubMed 10339604]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89076
Species: Hu, Ca
Applications: WB, IHC, IHC-P
NBP1-89626
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1793
Species: Hu, Mu, Rt, Pm
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19048
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-1519
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
NBP1-85731
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31717
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89726
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
7270-IL/CF
Species: Hu
H00008767-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for Septin-9 Antibody (H00010801-M01)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Septin-9 Antibody (H00010801-M01) (0)

There are no reviews for Septin-9 Antibody (H00010801-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Septin-9 Antibody (H00010801-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Septin-9 Products

Bioinformatics Tool for Septin-9 Antibody (H00010801-M01)

Discover related pathways, diseases and genes to Septin-9 Antibody (H00010801-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Septin-9 Antibody (H00010801-M01)

Discover more about diseases related to Septin-9 Antibody (H00010801-M01).
 

Pathways for Septin-9 Antibody (H00010801-M01)

View related products by pathway.

PTMs for Septin-9 Antibody (H00010801-M01)

Learn more about PTMs related to Septin-9 Antibody (H00010801-M01).
 

Research Areas for Septin-9 Antibody (H00010801-M01)

Find related products by research area.

Blogs on Septin-9

There are no specific blogs for Septin-9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Septin-9 Antibody (2C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPT9
Entrez
Uniprot