Septin-8 Antibody - Azide and BSA Free

Western Blot: Septin-8 Antibody [NBP2-93880] - Analysis of extracts of various cell lines, using Septin-8 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: Septin-8 Antibody [NBP2-93880] - Immunofluorescence analysis of C6 cells using Septin-8 antibody (NBP2-93880) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: Septin-8 Antibody [NBP2-93880] - Immunohistochemistry of paraffin-embedded Human thyroid cancer using Septin-8 Rabbit pAb (NBP2-93880) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: Septin-8 Antibody [NBP2-93880] - Analysis of L929 cells using Septin-8 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Septin-8 Antibody - Azide and BSA Free [Septin-8] - Immunofluorescence analysis of U-2 OS cells using Septin-8 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Septin-8 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Septin-8 Antibody - Azide and BSA Free (NBP2-93880) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 348-427 of human Septin-8 (NP_001287728.1). NKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDKKN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEPTIN8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Septin-8 Antibody - Azide and BSA Free

• KIAA0202SEP2
• septin 8
• septin-8

Background

SEPT8 is a member of the highly conserved septin family. Septins are 40- to 60-kD GTPases that assemble as filamentous scaffolds. They are involved in the organization of submembranous structures, in neuronal polarity, and in vesicle trafficking (Blaser et al., 2003 (PubMed 12909369)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SEPTIN8