Septin-10 Antibody


Western Blot: Septin-10 Antibody [NBP2-56906] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: Septin-10 Antibody [NBP2-56906] - Staining of human cell line A-431 shows localization to actin filaments.
Orthogonal Strategies: Western Blot: Septin-10 Antibody [NBP2-56906] - Analysis in human cell lines A-431 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Validated by:

Orthogonal Strategies


Order Details

Septin-10 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVG
Specificity of human Septin-10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Septin-10 Recombinant Protein Antigen (NBP2-56906PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Septin-10 Antibody

  • FLJ11619
  • septin 10
  • septin-10


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA, KD

Publications for Septin-10 Antibody (NBP2-56906) (0)

There are no publications for Septin-10 Antibody (NBP2-56906).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-10 Antibody (NBP2-56906) (0)

There are no reviews for Septin-10 Antibody (NBP2-56906). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Septin-10 Antibody (NBP2-56906) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Septin-10 Products

Bioinformatics Tool for Septin-10 Antibody (NBP2-56906)

Discover related pathways, diseases and genes to Septin-10 Antibody (NBP2-56906). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Septin-10 Antibody (NBP2-56906)

Discover more about diseases related to Septin-10 Antibody (NBP2-56906).

Pathways for Septin-10 Antibody (NBP2-56906)

View related products by pathway.

Research Areas for Septin-10 Antibody (NBP2-56906)

Find related products by research area.

Blogs on Septin-10

There are no specific blogs for Septin-10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Septin-10 Antibody and receive a gift card or discount.


Gene Symbol SEPT10