Septin-10 Antibody

Images

 
Western Blot: Septin-10 Antibody [NBP2-49221] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: Septin-10 Antibody [NBP2-49221] - Staining in human testis and pancreas tissues using anti-SEPT10 antibody. Corresponding SEPT10 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Septin-10 Antibody [NBP2-49221] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Septin-10 Antibody [NBP2-49221] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Septin-10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVG
Specificity
Specificity of human Septin-10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEPT10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Septin-10 Recombinant Protein Antigen (NBP2-49221PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Septin-10 Antibody

  • FLJ11619
  • septin 10
  • septin-10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-89626
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-13294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83824
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011086-Q01
Species: Hu
NBP1-85212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-47608
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90339
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13674
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB8224
Species: Mu
Applications: WB, CyTOF-ready, ICFlow
NBP2-54942
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Septin-10 Antibody (NBP2-49221) (0)

There are no publications for Septin-10 Antibody (NBP2-49221).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-10 Antibody (NBP2-49221) (0)

There are no reviews for Septin-10 Antibody (NBP2-49221). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Septin-10 Antibody (NBP2-49221) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Septin-10 Antibody (NBP2-49221)

Discover related pathways, diseases and genes to Septin-10 Antibody (NBP2-49221). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Septin-10 Antibody (NBP2-49221)

Discover more about diseases related to Septin-10 Antibody (NBP2-49221).
 

Pathways for Septin-10 Antibody (NBP2-49221)

View related products by pathway.

Research Areas for Septin-10 Antibody (NBP2-49221)

Find related products by research area.

Blogs on Septin-10

There are no specific blogs for Septin-10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Septin-10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPT10