SEPN1 Antibody

Images

 
Western Blot: SEPN1 Antibody [NBP1-69058] - Mouse Heart lysate, concentration 1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEPN1 Antibody Summary

Immunogen
Synthetic peptides corresponding to Sepn1 (selenoprotein N, 1) The peptide sequence was selected from the C terminal of Sepn1. Peptide sequence VHHINANYFLDITSMKPEDMENNNVFSFSSSFEDPSTATYMQFLREGLRR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEPN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against Sepn1 and was validated on Western blot.
Theoretical MW
62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SEPN1 Antibody

  • FLJ24021
  • rigid spine muscular dystrophy 1
  • RSMD1
  • RSS
  • selenoprotein N
  • selenoprotein N, 1
  • SelN
  • SELNMDRS1

Background

The function of Sepn1 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74190
Species: Mu
Applications: WB, ChIP
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69801
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IF
NB100-53795
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP1-69058
Species: Mu
Applications: WB, IHC

Publications for SEPN1 Antibody (NBP1-69058) (0)

There are no publications for SEPN1 Antibody (NBP1-69058).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEPN1 Antibody (NBP1-69058) (0)

There are no reviews for SEPN1 Antibody (NBP1-69058). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SEPN1 Antibody (NBP1-69058) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEPN1 Products

Bioinformatics Tool for SEPN1 Antibody (NBP1-69058)

Discover related pathways, diseases and genes to SEPN1 Antibody (NBP1-69058). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEPN1 Antibody (NBP1-69058)

Discover more about diseases related to SEPN1 Antibody (NBP1-69058).
 

Pathways for SEPN1 Antibody (NBP1-69058)

View related products by pathway.

PTMs for SEPN1 Antibody (NBP1-69058)

Learn more about PTMs related to SEPN1 Antibody (NBP1-69058).

Blogs on SEPN1

There are no specific blogs for SEPN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEPN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPN1
Uniprot