Home » SENP7 » SENP7 Antibodies » SENP7 Antibody (2D4)

SENP7 Antibody (2D4)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: SENP7 Antibody (2D4) [H00057337-M01] - Analysis of monoclonal antibody to SENP7 on HeLa cell . Antibody concentration 10 ug/ml.
Immunocytochemistry/ Immunofluorescence: SENP7 Antibody (2D4) [H00057337-M01] - Analysis of monoclonal antibody to SENP7 on HeLa cell . Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
2D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SENP7 Antibody (2D4) Summary

Immunogen
SENP7 (NP_065705, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDKRKLGRRPSSSEIITEGKRKKSSSDLSEIRKMLNAKPEDVHVQSPLSKFRSSERWTLPLQWERSLRNKVISLDHKNKKHIRGCPVTSRSSPERIPRVILTNVLGTELG
Specificity
SENP7 - SUMO1/sentrin specific peptidase 7
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SENP7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against recombinant protein on ELISA.
Publications
Read Publication using H00057337-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SENP7 Antibody (2D4)

  • EC 3.4.22.-
  • KIAA1707SUMO1/sentrin specific protease 7
  • MGC157730
  • Sentrin/SUMO-specific protease SENP7
  • sentrin-specific protease 7
  • SSP2
  • SUMO1/sentrin specific peptidase 7
  • SUMO-1-specific protease 2
  • SUSP2

Background

SENP7, SAE1, or SUMO-1 specific protease 2 is a ubiquitin-like (Ubl) protein that has been shown to bind to several protiens including Ran GTPase-activating protein 1 (RanGAP1), IkappaBalpha, and PML. These bindings implicate SUMO in the stabilization of the target proteins and/or their localization to subcellular complexes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SUMO1 Antibody
(SM1/495)
NBP2-32901
Immunohistochemistry-Paraffin: SUMO1 Antibody (SM1/495) [NBP2-32901] - Formalin-fixed, paraffin-embedded human tonsil stained with SUMO-1 MAb (SM1/495)
Flow Cytometry: SUMO1 Antibody (SM1/495) [NBP2-32901] - Flow Cytometric Analysis of paraformaldehyde-fixed HepG2 cells using SUMO1 Antibody (SM1/495) followed by goat anti- Mouse- IgG-CF488 (Blue); Isotype Control (Red).
Immunocytochemistry/Immunofluorescence: SUMO1 Antibody (SM1/495) [NBP2-32901] - Paraformaldehyde-fixed HepG2 cells stained with SUMO1 Antibody (SM1/495)followed by goat anti-Mouse IgG-CF488 (Green). Cell membranes are stained with Phalloidin (red).
(1 Review)
(2 Publications)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SENP6 Antibody
(4B7)
H00026054-M01
Western Blot: SENP6 Antibody (4B7) [H00026054-M01] - SENP6 monoclonal antibody (M01), clone 4B7 Analysis of SENP6 expression in IMR-32.
Flow Cytometry: SENP6 Antibody (4B7) [H00026054-M01] - SENP6 knockdown induces a hyper-acute apoptotic response in MSH2-deficient human cells. Efficient targeted knockdown of SENP6 or SENP7 in MSH2-deficient HEC59 cells. SENP6 protein was detected by flow cytometry (see Methods). Note specificity of SENP6 knockdown in response to siSENP6-C or siSENP6-1 [93], but not siSENP7 (pooled siSENP7-1 and siSENP7-2) or non-targeted siNT-1. Image collected and cropped by CiteAb from the following publication (http://genomemedicine.biomedcentral.com/articles/10.1186/s13073-014-0068-4), licensed under a CC-BY licence.
Flow Cytometry: SENP6 Antibody (4B7) [H00026054-M01] - SENP6 knockdown induces a hyper-acute apoptotic response in MSH2-deficient human cells. Efficient targeted knockdown of SENP6 in MSH2-deficient HEC59 cells. SENP6 protein was detected by flow cytometry (see Methods). Image collected and cropped by CiteAb from the following publication (http://genomemedicine.biomedcentral.com/articles/10.1186/s13073-014-0068-4), licensed under a CC-BY licence.
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
TRACP/PAP/ACP5
Antibody
H00000054-D01P
Western Blot: ACP5 Antibody [H00000054-D01P] - Analysis of ACP5 expression in transfected 293T cell line by ACP5 polyclonal antibody.Lane 1: ACP5 transfected lysate(36.60 KDa).Lane 2: Non-transfected lysate.
Western Blot: ACP5 Antibody [H00000054-D01P] - Analysis of ACP5 expression in human liver.
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
CD40 Ligand/TNFSF5
[HRP]
DCDL40
(42 Publications)
Species: Hu
Applications: ELISA
SCYL1 Antibody
(2E5)
H00057410-M02
Sandwich ELISA: SCYL1 Antibody (2E5) [H00057410-M02] - Detection limit for recombinant GST tagged SCYL1 is 0.03 ng/ml as a capture antibody.
Western Blot: SCYL1 Antibody (2E5) [H00057410-M02] - SCYL1 monoclonal antibody (M02), clone 2E5. Analysis of SCYL1 expression in PC-12.
Western Blot: SCYL1 Antibody (2E5) [H00057410-M02] - SCYL1 monoclonal antibody (M02), clone 2E5. Analysis of SCYL1 expression in Hela S3 NE.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
TDRD7 Antibody
NBP1-87315
Immunohistochemistry: TDRD7 Antibody [NBP1-87315] - Staining of human testis shows cytoplasmic and nuclear positivity in subsets of testicular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
TRAF-2 Antibody
NB100-56173
Immunocytochemistry/Immunofluorescence: TRAF-2 Antibody [NB100-56173] - Immunostaining of HN30 and MCF-12a cells for TRAF2 3 days post-transfectionMCF-12a NT (DAPI): non-treated MCF-12a DAPI stained, MCF-12a NT (TRAF2-FITC): non-treated MCF-12a FITC stained for TRAF2, MCF-12a pNSP 5a3a (DAPI): MCF-12a transfected with pcDNA 3.0 NSP 5a3a DAPI stained, MCF-12a pNSP 5a3a (TRAF2-FITC): MCF-12a transfected with pcDNA 3.0 NSP 5a3a FITC stained for Traf-2, HN30 NT (DAPI): non-treated HN30 DAPI stained, HN30 NT (TRAF2-FITC): non-treated HN30 FITC stained for TRAF2, HN30 pNSP 5a3a (DAPI): HN30 transfected with pcDNA 3.0 NSP 5a3a DAPI stained, HN30 pNSP 5a3a (TRAF2-FITC): HN30 transfected with pcDNA 3.0 NSP 5a3a FITC stained for TRAF2. White arrows indicate apoptotic bodies. Image collected and cropped by Citeab from the following publication (A novel dual signaling axis for NSP 5a3a induced apoptosis in head and neck carcinoma. Oncotarget (2011) licensed under a CC-BY licence.
Immunohistochemistry: TRAF-2 Antibody [NB100-56173] - Formalin-fixed, paraffin-embedded human melanoma tissue section stained for TRAF2 at 1:2000. A1 is a higher magnification of A. Hematoxylin-eosin counterstain.
Immunohistochemistry-Paraffin: TRAF-2 Antibody [NB100-56173] - Formalin-fixed, paraffin-embedded human colon carcinoma tissue sections stained for TRAF2 using this antibody at 1:2000. Hematoxylin-eosin counterstain.
(3 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
CSP Antibody
NBP1-87974
Western Blot: CSP Antibody [NBP1-87974] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CSP Antibody [NBP1-87974] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: CSP Antibody [NBP1-87974] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Species: Hu
Applications: IHC, IHC-P, WB
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Rat tissue extract (50ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody [GT1761] ) diluted at 1:1000.
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - A. 30 ug zebrafish heart lysate/extract 10 % SDS-PAGE Citrate synthetase antibody [GT1761] dilution: 1:1000
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
SENP1 Antibody
NB100-56405
Simple Western: SENP1 Antibody [NB100-56405] - Simple Western lane view shows a specific band for SENP1 in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: SENP1 Antibody [NB100-56405] - analysis of SENP1 in A) Daudi, B) HeLa and C) NIH 3T3 cell lysate using this antibody.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
IL-4 [Unconjugated]
6507-IL/CF
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.05-0.2 ng/mL.
(3 Publications)
Species: Hu
Applications: BA
SUMO2 Antibody
(SUMO2/1199)
NBP2-44477
Immunohistochemistry-Paraffin: SUMO2 Antibody (SUMO2/1199) [NBP2-44477] - Rat Ovary stained with SUMO-2 Monoclonal Antibody (SUMO2/1199)
Immunohistochemistry-Paraffin: SUMO2 Antibody (SUMO2/1199) [NBP2-44477] - Human Ovarian Carcinoma stained with SUMO-2 Monoclonal Antibody (SUMO2/1199)
Immunohistochemistry-Paraffin: SUMO2 Antibody (SUMO2/1199) [NBP2-44477] - Human Testicular Carcinoma stained with SUMO-2 Monoclonal Antibody (SUMO2/1199)
(1 Publication)
Species: Hu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
SUMO3 Antibody
(401513)
MAB2959
SUMO3 was detected in immersion fixed HEK293 human embryonic kidney cell line using Rat Anti-Human SUMO3 Monoclonal Antibody (Catalog # MAB2959) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
Species: Hu
Applications: ICC
PTDSS1 Antibody
NBP1-83060
Immunohistochemistry-Paraffin: PTDSS1 Antibody [NBP1-83060] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: PTDSS1 Antibody [NBP1-83060] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: PTDSS1 Antibody [NBP1-83060] - Staining of human kidney shows strong nuclear positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(2 Reviews)
(415 Publications)
Species: Hu
Applications: BA
SENP2 Antibody
(OTI3D3)
NBP2-03852
Flow Cytometry: SENP2 Antibody (3D3) [NBP2-03852] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-SENP2 antibody, and then analyzed by flow cytometry.
Western Blot: SENP2 Antibody (3D3) [NBP2-03852] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SENP2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SENP2.
Immunohistochemistry-Paraffin: SENP2 Antibody (3D3) [NBP2-03852] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-SENP2 mouse monoclonal antibody.
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - CD8 alpha expression in mouse spleen tissue using anti-CD8 alpha antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of bone marrow tissue by single and multiple staining.
Immunohistochemistry-Frozen: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of mosue spleen sections. CD8+ lymphocytes are marked by brown labeling of the cell surface.
(3 Reviews)
(20 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
CARD14 Antibody
NBP2-92873
Western Blot: CARD14 Antibody [NBP2-92873] - Analysis of extracts of various cell lines, using CARD14 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for SENP7 Antibody (H00057337-M01)(1)


Reviews for SENP7 Antibody (H00057337-M01) (0)

There are no reviews for SENP7 Antibody (H00057337-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SENP7 Antibody (H00057337-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SENP7 Products

Bioinformatics Tool for SENP7 Antibody (H00057337-M01)

Discover related pathways, diseases and genes to SENP7 Antibody (H00057337-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SENP7 Antibody (H00057337-M01)

Discover more about diseases related to SENP7 Antibody (H00057337-M01).
 

Pathways for SENP7 Antibody (H00057337-M01)

View related products by pathway.

PTMs for SENP7 Antibody (H00057337-M01)

Learn more about PTMs related to SENP7 Antibody (H00057337-M01).

Blogs on SENP7

There are no specific blogs for SENP7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SENP7 Antibody (2D4) and receive a gift card or discount.


Bioinformatics

Gene Symbol SENP7
Entrez
Uniprot