SENP7 Antibody (2D4)

Images

 
Immunocytochemistry/ Immunofluorescence: SENP7 Antibody (2D4) [H00057337-M01] - Analysis of monoclonal antibody to SENP7 on HeLa cell . Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
2D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SENP7 Antibody (2D4) Summary

Immunogen
SENP7 (NP_065705, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDKRKLGRRPSSSEIITEGKRKKSSSDLSEIRKMLNAKPEDVHVQSPLSKFRSSERWTLPLQWERSLRNKVISLDHKNKKHIRGCPVTSRSSPERIPRVILTNVLGTELG
Specificity
SENP7 - SUMO1/sentrin specific peptidase 7
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SENP7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against recombinant protein on ELISA.
Publications
Read Publication using H00057337-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SENP7 Antibody (2D4)

  • EC 3.4.22.-
  • KIAA1707SUMO1/sentrin specific protease 7
  • MGC157730
  • Sentrin/SUMO-specific protease SENP7
  • sentrin-specific protease 7
  • SSP2
  • SUMO1/sentrin specific peptidase 7
  • SUMO-1-specific protease 2
  • SUSP2

Background

SENP7, SAE1, or SUMO-1 specific protease 2 is a ubiquitin-like (Ubl) protein that has been shown to bind to several protiens including Ran GTPase-activating protein 1 (RanGAP1), IkappaBalpha, and PML. These bindings implicate SUMO in the stabilization of the target proteins and/or their localization to subcellular complexes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32901
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00026054-M01
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
H00000054-D01P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
DCDL40
Species: Hu
Applications: ELISA
H00057410-M02
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-87974
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56405
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-44477
Species: Hu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
MAB2959
Species: Hu
Applications: ICC
NBP1-83060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
285-IF
Species: Hu
Applications: BA
NBP2-03852
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP2-92873
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for SENP7 Antibody (H00057337-M01)(1)


Reviews for SENP7 Antibody (H00057337-M01) (0)

There are no reviews for SENP7 Antibody (H00057337-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SENP7 Antibody (H00057337-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SENP7 Products

Bioinformatics Tool for SENP7 Antibody (H00057337-M01)

Discover related pathways, diseases and genes to SENP7 Antibody (H00057337-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SENP7 Antibody (H00057337-M01)

Discover more about diseases related to SENP7 Antibody (H00057337-M01).
 

Pathways for SENP7 Antibody (H00057337-M01)

View related products by pathway.

PTMs for SENP7 Antibody (H00057337-M01)

Learn more about PTMs related to SENP7 Antibody (H00057337-M01).

Blogs on SENP7

There are no specific blogs for SENP7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SENP7 Antibody (2D4) and receive a gift card or discount.

Bioinformatics

Gene Symbol SENP7
Entrez
Uniprot