sen15 Antibody (8C7) - Azide and BSA Free

Western Blot: sen15 Antibody (8C7) [H00116461-M01] - C1orf19 monoclonal antibody (M01), clone 8C7 Analysis of C1orf19 expression in MCF-7.

Immunocytochemistry/Immunofluorescence: sen15 Antibody (8C7) [H00116461-M01] - Analysis of monoclonal antibody to C1orf19 on MCF-7 cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: sen15 Antibody (8C7) [H00116461-M01] - Detection limit for recombinant GST tagged C1orf19 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 8C7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

sen15 Antibody (8C7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse sen15 Antibody (8C7) - Azide and BSA Free (H00116461-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: C1orf19 (NP_443197, 72 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLR
• Specificity: C1orf19 (8C7)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TSEN15
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for sen15 Antibody (8C7) - Azide and BSA Free

• C1orf19
• chromosome 1 open reading frame 19
• hsSen15
• SEN15 homolog
• sen15
• tRNA splicing endonuclease 15 homolog (S. cerevisiae)
• tRNA-intron endonuclease Sen15
• tRNA-splicing endonuclease subunit Sen15

Background

tRNA splicing is a fundamental process required for cell growth and division. SEN15 is a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns, the first step in tRNA splicing (Paushkin et al., 2004 [PubMed 15109492]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSEN15
• Entrez:
  • 116461(Human)
• OMIM:
  • 608756(Human)
• Uniprot:
  • NP_443197(Human)