Semaphorin 5B Antibody - BSA Free

Immunohistochemistry-Paraffin: Semaphorin 5B Antibody [NBP2-56604] - Staining in human cerebral cortex and liver tissues using anti-SEMA5B antibody. Corresponding SEMA5B RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: Semaphorin 5B Antibody [NBP2-56604] - Staining of human cell line SH-SY5Y shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Semaphorin 5B Antibody [NBP2-56604] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: Semaphorin 5B Antibody [NBP2-56604] - Staining of human liver shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Semaphorin 5B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QESTLVHPATPNHLHYKGGGTPKNEKYTPMEFKTLNKNNLIPDDRANFYPLQQTNVYTTTYYPSPLNKHSFRPEASPGQRCFPN
• Predicted Species: Mouse (99%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEMA5B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: ICCI/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.
• Control Peptide:

  Semaphorin 5B Recombinant Protein Antigen (NBP2-56604PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Semaphorin 5B Antibody - BSA Free

• FLJ10372
• KIAA1445
• sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B
• SEMA5B
• SEMAG
• Semaphorin 5B
• SEMG

Background

Members of the semaphorin protein family, such as SEMA5B, are involved in axonal guidance during neural development (Adams et al., 1996 (PubMed 8817451)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Semaphorin 5B Antibody (NBP2-56604)(1)

Publication using NBP2-56604

• Rossaint J, Meersch M, Thomas K et al. Remote ischemic preconditioning causes transient cell-cycle arrest and renal protection by a NF-kB-dependent Sema5B pathway JCI insight 2022-06-21 [PMID: 35727636] (WB, Mouse)

Bioinformatics

• Gene Symbol: SEMA5B