We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Semaphorin 5A Recombinant Protein Antigen

Images

 
There are currently no images for Semaphorin 5A Protein (NBP1-80767PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Semaphorin 5A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SEMA5A.

Source: E. coli

Amino Acid Sequence: PWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWSEWSDWSECEASGVQVRARQCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEEKRCGE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SEMA5A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80767.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Semaphorin 5A Recombinant Protein Antigen

  • FLJ12815
  • sema domain, seven thrombospondin repeats (type 1 and type 1-like)
  • Sema F
  • SEMA5A
  • SEMAF
  • Semaphorin 5A
  • semaphorin F
  • semaphorin-5A
  • Semaphorin-F
  • semF
  • transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A

Background

Members of the semaphorin protein family are involved in axonal guidance during neural development. Semaphorin 5a is thought to have a bifunctional role in axon guidance, exerting both attractive and inhibitory effects on developing axons associated with limbic function. The thrombospondin repeats of Semaphorin 5a physically interact with both heparan sulfate proteoglycans and chondroitin sulfate proteoglycans, inducing attractive and inhibitory guidance cues, respectively. The biological responses to Semaphorin 5a are induced through binding to its high-affinity receptor, plexin B3, triggering intracellular signaling through Met.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

5896-S5
Species: Hu
Applications: BA
AF4958
Species: Hu
Applications: CyTOF-ready, Flow, WB
3237-S3
Species: Mu
Applications: BA
AF2009
Species: Hu
Applications: ICC, IHC
AF7895
Species: Hu
Applications: IHC, WB
NBP2-02852
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-91941
Species: Hu
Applications: IHC,  IHC-P, WB
H00001501-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
AF5235
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-15016
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF567
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
AF8277
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
1250-S3
Species: Hu
Applications: BA, BA
NBP1-32740
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
1109-N1
Species: Mu
Applications: Bind
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB

Publications for Semaphorin 5A Protein (NBP1-80767PEP) (0)

There are no publications for Semaphorin 5A Protein (NBP1-80767PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 5A Protein (NBP1-80767PEP) (0)

There are no reviews for Semaphorin 5A Protein (NBP1-80767PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Semaphorin 5A Protein (NBP1-80767PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Semaphorin 5A Products

Research Areas for Semaphorin 5A Protein (NBP1-80767PEP)

Find related products by research area.

Blogs on Semaphorin 5A

There are no specific blogs for Semaphorin 5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Semaphorin 5A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA5A