Semaphorin 4F Antibody - BSA Free

Immunohistochemistry-Paraffin: Semaphorin 4F Antibody [NBP2-68815] - Staining of human retina shows moderate cytoplasmic positivity in nerve fiber layer.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Semaphorin 4F Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEMA4F
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  Semaphorin 4F Recombinant Protein Antigen (NBP2-68815PEP)

Reactivity Notes

Mouse 86%, Rat 87%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Semaphorin 4F Antibody - BSA Free

• M-SEMA
• m-Sema-M
• PRO2353
• sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4F
• sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, 4F
• Sema M
• Sema W
• SEMA4F
• SEMAM
• Semaphorin 4F
• semaphorin-4F
• semaphorin-M
• semaphorin-W
• SEMAW
• SEMAWsemaphorin M

Background

SEMA4F has growth cone collapse activity against retinal ganglion-cell axons

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEMA4F