Semaphorin 4B Antibody


Western Blot: SEMA4B Antibody [NBP1-69276] - This Anti-SEMA4B antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Semaphorin 4B Antibody Summary

Synthetic peptides corresponding to SEMA4B(sema domain, immunoglobulin domain (Ig), (semaphorin) 4B) The peptide sequence was selected from the N terminal of SEMA4B. Peptide sequence KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SEMA4B and was validated on Western blot.
Theoretical MW
93 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Semaphorin 4B Antibody

  • KIAA1745sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, 4B
  • MGC131831
  • sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4B
  • SEMA4B
  • Semaphorin 4B
  • semaphorin-4B
  • SemC


SEMA4B is a single-pass type I membrane protein. It belongs to the semaphorin family. SEMA4B contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB

Publications for Semaphorin 4B Antibody (NBP1-69276) (0)

There are no publications for Semaphorin 4B Antibody (NBP1-69276).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 4B Antibody (NBP1-69276) (0)

There are no reviews for Semaphorin 4B Antibody (NBP1-69276). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Semaphorin 4B Antibody (NBP1-69276) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Semaphorin 4B Products

Bioinformatics Tool for Semaphorin 4B Antibody (NBP1-69276)

Discover related pathways, diseases and genes to Semaphorin 4B Antibody (NBP1-69276). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 4B Antibody (NBP1-69276)

Discover more about diseases related to Semaphorin 4B Antibody (NBP1-69276).

Pathways for Semaphorin 4B Antibody (NBP1-69276)

View related products by pathway.

PTMs for Semaphorin 4B Antibody (NBP1-69276)

Learn more about PTMs related to Semaphorin 4B Antibody (NBP1-69276).

Research Areas for Semaphorin 4B Antibody (NBP1-69276)

Find related products by research area.

Blogs on Semaphorin 4B

There are no specific blogs for Semaphorin 4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Semaphorin 4B Antibody and receive a gift card or discount.


Gene Symbol SEMA4B