Semaphorin 4B Antibody - BSA Free

Western Blot: SEMA4B Antibody [NBP1-69276] - This Anti-SEMA4B antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

Product Discontinued

Semaphorin 4B Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SEMA4B(sema domain, immunoglobulin domain (Ig), (semaphorin) 4B) The peptide sequence was selected from the N terminal of SEMA4B. Peptide sequence KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEMA4B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 93 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Semaphorin 4B Antibody - BSA Free

• KIAA1745sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, 4B
• MGC131831
• sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4B
• SEMA4B
• SEMAC
• Semaphorin 4B
• semaphorin-4B
• SemC

Background

SEMA4B is a single-pass type I membrane protein. It belongs to the semaphorin family. SEMA4B contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEMA4B
• Uniprot:
  • Q2NL81(Human)