SELM Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SELM Antibody [NBP1-90883] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: SELM Antibody [NBP1-90883] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SELM Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SELM Antibody - BSA Free (NBP1-90883) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SELM Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SELENOM
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot Reported in the scientific literature (PMID: 23880772)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SELM Protein (NBP1-90883PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24519931). Rat (83%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SELM Antibody - BSA Free

• MGC40146
• selenoprotein M
• selenoprotein SelM
• SEPM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SELM Antibody (NBP1-90883)(2)

Publications using NBP1-90883

• Byrns CN, Pitts MW, Gilman CA et al. Mice Lacking Selenoprotein P and Selenocysteine Lyase Exhibit Severe Neurological Dysfunction, Neurodegeneration, and Audiogenic Seizures. J Biol Chem 2014-04-04 [PMID: 24519931] (IF/IHC, Mouse)
• Pitts MW, Reeves MA, Hashimoto AC et al. Deletion of Selenoprotein M Leads to Obesity Without Cognitive Deficits. J Biol Chem. 2013-07-23 [PMID: 23880772] (WB, Human)

Bioinformatics

• Gene Symbol: SELENOM