Recombinant Human Secretin Protein

Images

 
SDS-Page: Recombinant Human Secretin Protein [H00006343-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Secretin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-121 of Human SCT full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SCT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
39.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Secretin Protein

  • secretin

Background

Secretin belongs to the glucagon family. This protein is an endocrine hormone and its major site of production is the endocrine S cells located in the proximal small intestinal mucosa. The release of active secretin is stimulated by either fatty acids or an acidic pH in the duodenum. This hormone stimulates the secretion of bicarbonate-rich pancreatic fluids and has also been shown to regulate the growth and development of the stomach, small intestine, and pancreas. Secretin deficiency has been implicated in autistic syndrome, suggesting that the hormone could have a neuroendocrine function in addition to its role in digestion. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
H00008767-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1793
Species: Hu, Mu, Mk
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
MAB8864
Species: Hu
Applications: IHC
AF6380
Species: Mu
Applications: WB
NBP2-49600
Species: Hu
Applications: IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NBP1-92287
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-68008
Species: Hu
NBP2-44318
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF3145
Species: Hu
Applications: WB
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for Secretin Recombinant Protein (H00006343-P01) (0)

There are no publications for Secretin Recombinant Protein (H00006343-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Secretin Recombinant Protein (H00006343-P01) (0)

There are no reviews for Secretin Recombinant Protein (H00006343-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Secretin Recombinant Protein (H00006343-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Secretin Products

Bioinformatics Tool for Secretin Recombinant Protein (H00006343-P01)

Discover related pathways, diseases and genes to Secretin Recombinant Protein (H00006343-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Secretin Recombinant Protein (H00006343-P01)

Discover more about diseases related to Secretin Recombinant Protein (H00006343-P01).
 

Pathways for Secretin Recombinant Protein (H00006343-P01)

View related products by pathway.

Blogs on Secretin

There are no specific blogs for Secretin, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Secretin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCT
COVID-19 update