Sec8 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Sec8 Antibody [NBP1-89597] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli.

Immunohistochemistry-Paraffin: Sec8 Antibody [NBP1-89597] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Staining of human pancreas shows very weak positivity in exocrine glandular cells.

Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Analysis in human cell line CAPAN-2.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Sec8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Sec8 Antibody - BSA Free (NBP1-89597) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Sec8 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QHKFQYIFEGLGHLISCILINGAQYFRRISESGIKKMCRNIFVLQQNLTNITMSREADLDFARQYYEMLYNTADELLNLVVDQGVKYTELEYIHALTLLHRSQTGVGELTTQNTRLQRLKEIICEQAAIKQATKD
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EXOC4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Sec8 Protein (NBP1-89597PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Sec8 Antibody - BSA Free

• exocyst complex component 4
• KIAA1699SEC8L1
• MGC27170
• REC8
• SEC8Exocyst complex component Sec8
• SEC8-like 1 (S. cerevisiae)
• SEC8-like 1
• Sec8p

Background

Sec8 is encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Sec8 Antibody (NBP1-89597)(1)

Publication using NBP1-89597

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: EXOC4