Sec8 Antibody

Immunohistochemistry-Paraffin: Sec8 Antibody [NBP1-83944] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Sec8 Antibody [NBP1-83944] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: Sec8 Antibody [NBP1-83944] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Sec8 Antibody [NBP1-83944] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Staining of human cell line U-2 OS shows localization to cytosol.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Sec8 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RDHLRGQAGFFSTPGGASRDGSGPGEEGKQRTLTTLLEKVEGCRHLLETPGQYLVYNGDLVEYDADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNAL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EXOC4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Sec8 Antibody

• exocyst complex component 4
• KIAA1699SEC8L1
• MGC27170
• REC8
• SEC8Exocyst complex component Sec8
• SEC8-like 1 (S. cerevisiae)
• SEC8-like 1
• Sec8p

Background

Sec8 is encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EXOC4