SEC61B Recombinant Protein Antigen

Images

 
There are currently no images for SEC61B Protein (NBP2-13290PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SEC61B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SEC61B.

Source: E. coli

Amino Acid Sequence: AAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SEC61B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13290.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SEC61B Recombinant Protein Antigen

  • protein translocation complex beta
  • protein transport protein SEC61 beta subunit
  • protein transport protein Sec61 subunit beta
  • Sec61 beta subunit
  • Sec61 complex, beta subunit
  • SEC61B

Background

The SEC61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the SEC61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins alpha, beta, and gamma. This gene encodes the beta subunit protein. The SEC61 subunits are also observed in the post ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94505
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00000439-M03
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP3-13179
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-54686
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49284
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-48440
Species: Hu, Ze
Applications: IHC, WB
AF6438
Species: Hu, Mu, Rt
Applications: ICC, WB
236-EG
Species: Hu
Applications: BA
AF5687
Species: Hu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP1-88071
Species: Hu
Applications: IHC,  IHC-P
NBP1-86732
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PA, Simple Western, WB
DRA00B
Species: Hu
Applications: ELISA
NBP1-85026
Species: Hu
Applications: IHC,  IHC-P
NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for SEC61B Protein (NBP2-13290PEP) (0)

There are no publications for SEC61B Protein (NBP2-13290PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC61B Protein (NBP2-13290PEP) (0)

There are no reviews for SEC61B Protein (NBP2-13290PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SEC61B Protein (NBP2-13290PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SEC61B Products

Array NBP2-13290PEP

Research Areas for SEC61B Protein (NBP2-13290PEP)

Find related products by research area.

Blogs on SEC61B

There are no specific blogs for SEC61B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SEC61B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC61B