SEC61B Antibody [Allophycocyanin]

Product Discontinued

SEC61B Antibody [Allophycocyanin] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-96 of human SEC61B (NP_006799.1).
  
  Sequence:
  MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEC61B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for SEC61B Antibody [Allophycocyanin]

• protein translocation complex beta
• protein transport protein SEC61 beta subunit
• protein transport protein Sec61 subunit beta
• Sec61 beta subunit
• Sec61 complex, beta subunit
• SEC61B

Background

The SEC61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the SEC61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins alpha, beta, and gamma. This gene encodes the beta subunit protein. The SEC61 subunits are also observed in the post ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEC61B