SEC3 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SEC3. Source: E. coli Amino Acid Sequence: CISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFH Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
EXOC1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55234. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SEC3 Recombinant Protein Antigen
Background
The EXOC1 (also known as SEC3) gene encodes an exocyst complex component 1 protein, that in isoform 1 is 894 amino acids long and nearly 102 kDA and in isoform 2 is 879 amino acids long and 100 kDA. The EXOC1 gene functions in the docking of exocytic vesicles with fusion sites on the plasma membrane. EXOC1 participates in the insulin pathway, Arf6 trafficking events, exocyst complex formation, and the metabolism of proteins through interacts with genes EXOC4, PKP3, LUC7L2, CDC5L, and C7orf55-LUC7L2. EXOC1 has been linked to toxic shock syndrome, schizophrenia, and mucopolysaccharidosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Ch, Fi, Gp, Ha, Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Ch, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Ye
Applications: IB, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for SEC3 Recombinant Protein Antigen (NBP2-55234PEP) (0)
There are no publications for SEC3 Recombinant Protein Antigen (NBP2-55234PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SEC3 Recombinant Protein Antigen (NBP2-55234PEP) (0)
There are no reviews for SEC3 Recombinant Protein Antigen (NBP2-55234PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SEC3 Recombinant Protein Antigen (NBP2-55234PEP) (0)
Additional SEC3 Products
Research Areas for SEC3 Recombinant Protein Antigen (NBP2-55234PEP)
Find related products by research area.
|
Blogs on SEC3