We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SEC23IP Recombinant Protein Antigen

Images

 
There are currently no images for SEC23IP Recombinant Protein Antigen (NBP2-58361PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SEC23IP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to SEC23IP.

Source: E. coli

Amino Acid Sequence: CPGPLAVANGVVKQLHFQEKQMPEEPKLTLDESYDLVVENEEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SEC23IP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58361.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SEC23IP Recombinant Protein Antigen

  • P125
  • P125A
  • SEC23 interacting protein
  • SEC23-interacting protein

Background

COPII-coated vesicles are involved in protein transport from the endoplasmic reticulum to the Golgi apparatus. The protein encoded by this gene was identified by its interaction with a mouse protein similar to yeast Sec23p, an essential component of the COPII. This protein shares significant similarity with phospholipid-modifying proteins, especially phosphatidic acid preferring-phospholipase A1. Overexpression of this protein has been shown to cause disorganization of the endoplasmic reticulum-Golgi intermediate compartment and Golgi apparatus, which suggests its role in the early secretory pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-12897
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24459
Species: Ca, Ch, Hu, Mu, Pm, Rb, Rt, RM, Xp, Ze
Applications: ICC/IF, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP3-39309
Species: Hu
Applications: ELISA
NBP1-88650
Species: Hu
Applications:  IHC-P, KD, WB
NBP3-03282
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
H00010714-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-18225
Species: Hu, Mu, Rt
Applications: ICC/IF,  IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for SEC23IP Recombinant Protein Antigen (NBP2-58361PEP) (0)

There are no publications for SEC23IP Recombinant Protein Antigen (NBP2-58361PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC23IP Recombinant Protein Antigen (NBP2-58361PEP) (0)

There are no reviews for SEC23IP Recombinant Protein Antigen (NBP2-58361PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SEC23IP Recombinant Protein Antigen (NBP2-58361PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SEC23IP Products

Research Areas for SEC23IP Recombinant Protein Antigen (NBP2-58361PEP)

Find related products by research area.

Blogs on SEC23IP

There are no specific blogs for SEC23IP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SEC23IP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC23IP