SEC13 Antibody

Western Blot: SEC13L1 Antibody [H00006396-B02P] - Analysis of SEC13 expression in transfected 293T cell line by SEC13 polyclonal antibody. Lane 1: SEC13 transfected lysate(35.9 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: SEC13L1 Antibody [H00006396-B02P] - Analysis of purified antibody to SEC13 on HeLa cell. (antibody concentration 10 ug/ml)

Product Discontinued

SEC13 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: SEC13 (AAH02634.2, 1 a.a. - 325 a.a.) full-length human protein. MGKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: SEC13
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: It has been used for WB and Functional.

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:33479349)

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SEC13 Antibody

• D3S1231E
• D3S1231ESEC13L1npp-20
• Npp-20
• protein SEC13 homolog
• SEC13 (S. cerevisiae)-like 1
• SEC13 homolog (S. cerevisiae)
• SEC13
• SEC13L1
• SEC13-like 1 isoform
• SEC13-like protein 1
• SEC13R
• SEC13-related protein
• SEC13RSEC13-like 1 (S. cerevisiae)

Background

SEC13L1 is encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SEC13 Antibody (H00006396-B02P)(1)

Publication using H00006396-B02P

• Dieterich IA, Cui Y, Braun MM, et al. Acetyl-CoA flux from the cytosol to the ER regulates engagement and quality of the secretory pathway Scientific reports 2021-01-21 [PMID: 33479349] (ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: SEC13
• Uniprot:
  • AAH02634.2(Human)