SEC13 Antibody (1G7)

Images

 
Immunocytochemistry/ Immunofluorescence: SEC13L1 Antibody (1G7) [H00006396-M02] - Analysis of monoclonal antibody to SEC13 on HeLa cell. Antibody concentration 40 ug/ml.
Sandwich ELISA: SEC13L1 Antibody (1G7) [H00006396-M02] - Detection limit for recombinant GST tagged SEC13 is 0.03 ng/ml as a capture antibody.
Immunoprecipitation: SEC13L1 Antibody (1G7) [H00006396-M02] - Analysis of SEC13 transfected lysate using anti-SEC13 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SEC13 MaxPab rabbit polyclonal ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF, IP
Clone
1G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SEC13 Antibody (1G7) Summary

Immunogen
SEC13 (NP_109598 226 a.a. - 324 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNE
Specificity
Reacts with SEC13 homolog (S. cerevisiae).
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SEC13
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SEC13 Antibody (1G7)

  • D3S1231E
  • D3S1231ESEC13L1npp-20
  • Npp-20
  • protein SEC13 homolog
  • SEC13 (S. cerevisiae)-like 1
  • SEC13 homolog (S. cerevisiae)
  • SEC13
  • SEC13L1
  • SEC13-like 1 isoform
  • SEC13-like protein 1
  • SEC13R
  • SEC13-related protein
  • SEC13RSEC13-like 1 (S. cerevisiae)

Background

The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-86263
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31874
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1799
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IP
AF5557
Species: Hu
Applications: WB
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-34842
Species: Hu, Mu, Rt, Ha
Applications: WB, Flow, ICC/IF, IP
NBP1-82456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76926
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32725
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93325
Species: Hu
Applications: WB, IP
NBP1-80773
Species: Hu
Applications: IHC, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP

Publications for SEC13 Antibody (H00006396-M02) (0)

There are no publications for SEC13 Antibody (H00006396-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC13 Antibody (H00006396-M02) (0)

There are no reviews for SEC13 Antibody (H00006396-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SEC13 Antibody (H00006396-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEC13 Products

Bioinformatics Tool for SEC13 Antibody (H00006396-M02)

Discover related pathways, diseases and genes to SEC13 Antibody (H00006396-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC13 Antibody (H00006396-M02)

Discover more about diseases related to SEC13 Antibody (H00006396-M02).
 

Pathways for SEC13 Antibody (H00006396-M02)

View related products by pathway.

PTMs for SEC13 Antibody (H00006396-M02)

Learn more about PTMs related to SEC13 Antibody (H00006396-M02).

Blogs on SEC13

There are no specific blogs for SEC13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC13 Antibody (1G7) and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC13
Entrez