SCP3/SYCP3 Recombinant Protein Antigen

Images

 
There are currently no images for SCP3/SYCP3 Recombinant Protein Antigen (NBP2-48713PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SCP3/SYCP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SYCP3.

Source: E. coli

Amino Acid Sequence: ILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SYCP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48713.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SCP3/SYCP3 Recombinant Protein Antigen

  • COR1
  • MGC71888
  • SCP3 chromosome 3 open reading frame 8
  • SCP3 COR1
  • SCP3
  • SCP-3
  • SYCP3
  • synaptonemal complex protein 3

Background

SCP3 is a major component of the transverse filaments of the synaptonemal complexes that mediate synapses during the zygotene stage. SCP-3 is formed between homologus chromosomes during meiotic prophase, and plays an essential role in the meiotic function of spermatogenesis. Therefore, this protein is necessary for proper testis development and defects in the SYCP3 gene can lead to azoospermia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-229
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-72110
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB100-56648
Species: Hu, Mu, Rt
Applications: WB
NBP2-94045
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
AF2030
Species: Hu
Applications: IHC, WB
NB100-181
Species: Hu, Mu
Applications: IP, WB
NBP1-98492
Species: Hu, Mu
Applications: ICC/IF, KO, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-207
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-2437
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PCR, PEP-ELISA, WB
NBP2-02667
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32283
Species: Hu, Mu, Rt
Applications: WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NBP1-87145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85958
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
AF2288
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-89966
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SCP3/SYCP3 Recombinant Protein Antigen (NBP2-48713PEP) (0)

There are no publications for SCP3/SYCP3 Recombinant Protein Antigen (NBP2-48713PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCP3/SYCP3 Recombinant Protein Antigen (NBP2-48713PEP) (0)

There are no reviews for SCP3/SYCP3 Recombinant Protein Antigen (NBP2-48713PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SCP3/SYCP3 Recombinant Protein Antigen (NBP2-48713PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCP3/SYCP3 Products

Research Areas for SCP3/SYCP3 Recombinant Protein Antigen (NBP2-48713PEP)

Find related products by research area.

Blogs on SCP3/SYCP3.

SCP3: A Key to Meiotic Recombination, Sterility and Cancer
Synaptonemal Complex Protein 3 (SCP3), which is a protein present in the synaptonemal complex which is responsible for pairing, synapsis, and recombination of homologous chromosomes during meiosis. Meiosis, in basic terms, is where germ cells divide t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SCP3/SYCP3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SYCP3