SCNN1D Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

SCNN1D Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCNN1D.
  
  

  Source: E. coli

  Amino Acid Sequence: ELLDEFARENIDSLYNVNLSKGRAALSATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSGVAAVQDWYHFHYVDILALLPAAWEDSHGSQDGHFVLSCSYDGLDCQARQFRTFHHPTYGSCYTVDG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SCNN1D
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85004.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SCNN1D Recombinant Protein Antigen

• Delta-ENaC
• Delta-NaCH
• DNACH
• ENaCD
• MGC149710
• MGC149711
• SCNED
• SCNN1D
• sodium channel, nonvoltage-gated 1, delta
• voltage-gated, type I, delta polypeptide

Background

SCNN1D is a subunit of the epithelial sodium channel (ENaC). ENaC has high sodium selectivity, low conductance, and amiloride sensitivity. The epithelial Na(+) channel (ENaC) regulates Na(+) homeostasis in cells and across epithelia; in the kidney, lung and colon it plays an essential role in trans-epithelial sodium and fluid balance. ENaC also mediates aldosterone-dependent sodium re-uptake in the distal nephron of the kidney, thus regulating blood pressure. Four homologous ENaC subunits (alpha, beta, gamma, and delta) have been isolated in mammals. Combination of alpha-, beta-, and gamma-subunits or delta-, beta-, and gamma-subunits forms fully functional channels. A delta subunit can replace the alpha subunit. However, the pharmacology, sensitivity to amiloride, conductance, and ionic selectivity of the delta/beta-gamma channel are different from those of the alpha/beta-gamma channel. FUNCTION: Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception. SUBUNIT: Heterotetramer of two alpha, one beta and one gamma subunit. A delta subunit can replace the alpha subunit. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SCNN1D