SCNN1D Recombinant Protein Antigen

Images

 
There are currently no images for SCNN1D Protein (NBP1-85004PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SCNN1D Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCNN1D.

Source: E. coli

Amino Acid Sequence: ELLDEFARENIDSLYNVNLSKGRAALSATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSGVAAVQDWYHFHYVDILALLPAAWEDSHGSQDGHFVLSCSYDGLDCQARQFRTFHHPTYGSCYTVDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SCNN1D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85004. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SCNN1D Recombinant Protein Antigen

  • Delta-ENaC
  • Delta-NaCH
  • DNACH
  • ENaCD
  • MGC149710
  • MGC149711
  • SCNED
  • SCNN1D
  • sodium channel, nonvoltage-gated 1, delta
  • voltage-gated, type I, delta polypeptide

Background

SCNN1D is a subunit of the epithelial sodium channel (ENaC). ENaC has high sodium selectivity, low conductance, and amiloride sensitivity. The epithelial Na(+) channel (ENaC) regulates Na(+) homeostasis in cells and across epithelia; in the kidney, lung and colon it plays an essential role in trans-epithelial sodium and fluid balance. ENaC also mediates aldosterone-dependent sodium re-uptake in the distal nephron of the kidney, thus regulating blood pressure. Four homologous ENaC subunits (alpha, beta, gamma, and delta) have been isolated in mammals. Combination of alpha-, beta-, and gamma-subunits or delta-, beta-, and gamma-subunits forms fully functional channels. A delta subunit can replace the alpha subunit. However, the pharmacology, sensitivity to amiloride, conductance, and ionic selectivity of the delta/beta-gamma channel are different from those of the alpha/beta-gamma channel. FUNCTION: Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception. SUBUNIT: Heterotetramer of two alpha, one beta and one gamma subunit. A delta subunit can replace the alpha subunit. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74357
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP3-18257
Species: Ha, Hu, Mu, Rt, Xp
Applications: ICC/IF, IHC, IP, WB
NBP2-22409
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP3-18256
Species: Ha, Hu, Mu, Rt, Xp
Applications: IHC, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-30876
Species: Hu
Applications: IHC,  IHC-P
NB100-612
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-14321
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-24479
Species: Bv, Ca, Eq, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02521
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-146
Species: Bv, Ca, Dr, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh, Xp, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-76289
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-94614
Species: Mu, Rt
Applications: WB
NBP1-36975
Species: Ha(-)
Applications: ICC/IF, PEP-ELISA
AF482
Species: Mu
Applications: IHC, WB

Publications for SCNN1D Protein (NBP1-85004PEP) (0)

There are no publications for SCNN1D Protein (NBP1-85004PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCNN1D Protein (NBP1-85004PEP) (0)

There are no reviews for SCNN1D Protein (NBP1-85004PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SCNN1D Protein (NBP1-85004PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCNN1D Products

Blogs on SCNN1D

There are no specific blogs for SCNN1D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SCNN1D Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SCNN1D