Recombinant Human SCNN1D Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SCNN1D Protein Summary

Description
SCNN1D (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: CFYRLYQDLETHRLPCTSRCPRPCRESAFKLSTGTSRWPSAKSAGWTLATLGEQGLPHQSHRQRSSLAKINIVYQELNYRSVEEAPVYSVPQLLSAMGS
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SCNN1D

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCNN1D Protein

  • Delta-ENaC
  • Delta-NaCH
  • DNACH
  • ENaCd
  • MGC149710
  • MGC149711
  • SCNED
  • sodium channel, nonvoltage-gated 1, delta
  • voltage-gated, type I, delta polypeptide

Background

SCNN1D - sodium channel, nonvoltage-gated 1, delta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74357
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
NBP1-84844
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22409
Species: Mu
Applications: WB, ICC/IF, IHC
NBP2-41371
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, S-ELISA, ELISA(Cap)
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30887
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-611
Species: Hu
Applications: WB, IP
NB300-188
Species: Rt
Applications: IHC, IHC-P
NBP2-24479
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP2-02521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-146
Species: Hu, Mu, Rt, Po, Bv, Ca, Dr, GP, Pm, Rb, Xp, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1555
Species: Hu
Applications: WB
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-76289
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, ICC
H00000480-R04
Species: Hu
NBP1-36975
Species: Ha(-)
Applications: ICC/IF, PEP-ELISA
AF482
Species: Mu
Applications: WB, IHC

Publications for SCNN1D Partial Recombinant Protein (H00006339-Q01) (0)

There are no publications for SCNN1D Partial Recombinant Protein (H00006339-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCNN1D Partial Recombinant Protein (H00006339-Q01) (0)

There are no reviews for SCNN1D Partial Recombinant Protein (H00006339-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCNN1D Partial Recombinant Protein (H00006339-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCNN1D Products

Bioinformatics Tool for SCNN1D Partial Recombinant Protein (H00006339-Q01)

Discover related pathways, diseases and genes to SCNN1D Partial Recombinant Protein (H00006339-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCNN1D Partial Recombinant Protein (H00006339-Q01)

Discover more about diseases related to SCNN1D Partial Recombinant Protein (H00006339-Q01).
 

Pathways for SCNN1D Partial Recombinant Protein (H00006339-Q01)

View related products by pathway.

PTMs for SCNN1D Partial Recombinant Protein (H00006339-Q01)

Learn more about PTMs related to SCNN1D Partial Recombinant Protein (H00006339-Q01).

Blogs on SCNN1D

There are no specific blogs for SCNN1D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCNN1D Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCNN1D