SCNN1D Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

SCNN1D Partial Recombinant Protein Summary

Description
SCNN1D (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: CFYRLYQDLETHRLPCTSRCPRPCRESAFKLSTGTSRWPSAKSAGWTLATLGEQGLPHQSHRQRSSLAKINIVYQELNYRSVEEAPVYSVPQLLSAMGS
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
SCNN1D

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SCNN1D Partial Recombinant Protein

  • Delta-ENaC
  • Delta-NaCH
  • DNACH
  • ENaCd
  • MGC149710
  • MGC149711
  • SCNED
  • sodium channel, nonvoltage-gated 1, delta
  • voltage-gated, type I, delta polypeptide

Background

SCNN1D - sodium channel, nonvoltage-gated 1, delta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74357
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-84844
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22409
Species: Mu
Applications: WB, ICC/IF, IHC
NBP2-41371
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, S-ELISA, ELISA(Cap)
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30887
Species: Hu
Applications: IHC, IHC-P
NB100-611
Species: Hu
Applications: WB, IP
NBP2-14321
Species: Hu
Applications: IHC, IHC-P
NBP2-24479
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP2-02521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-146
Species: Hu, Mu, Rt, Po, Bv, Ca, Dr, GP, Pm, Rb, Xp, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3994
Species: Hu
Applications: WB
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-76289
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, ICC
H00000480-R04
Species: Hu
NBP1-36975
Species: Ha(-)
Applications: ICC/IF, PEP-ELISA
AF482
Species: Mu
Applications: WB, IHC
H00006339-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SCNN1D Partial Recombinant Protein (H00006339-Q01) (0)

There are no publications for SCNN1D Partial Recombinant Protein (H00006339-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCNN1D Partial Recombinant Protein (H00006339-Q01) (0)

There are no reviews for SCNN1D Partial Recombinant Protein (H00006339-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCNN1D Partial Recombinant Protein (H00006339-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCNN1D Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for SCNN1D Partial Recombinant Protein (H00006339-Q01)

Discover related pathways, diseases and genes to SCNN1D Partial Recombinant Protein (H00006339-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCNN1D Partial Recombinant Protein (H00006339-Q01)

Discover more about diseases related to SCNN1D Partial Recombinant Protein (H00006339-Q01).
 

Pathways for SCNN1D Partial Recombinant Protein (H00006339-Q01)

View related products by pathway.

PTMs for SCNN1D Partial Recombinant Protein (H00006339-Q01)

Learn more about PTMs related to SCNN1D Partial Recombinant Protein (H00006339-Q01).

Blogs on SCNN1D

There are no specific blogs for SCNN1D, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SCNN1D

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00006339-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought