SCNN1D Antibody (2F3)

Images

 
There are currently no images for SCNN1D Antibody (H00006339-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SCNN1D Antibody (2F3) Summary

Immunogen
SCNN1D (NP_002969 432 a.a. - 530 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CFYRLYQDLETHRLPCTSRCPRPCRESAFKLSTGTSRWPSAKSAGWTLATLGEQGLPHQSHRQRSSLAKINIVYQELNYRSVEEAPVYSVPQLLSAMGS
Specificity
SCNN1D (2F3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SCNN1D
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SCNN1D Antibody (2F3)

  • Delta-ENaC
  • Delta-NaCH
  • DNACH
  • ENaCd
  • MGC149710
  • MGC149711
  • SCNED
  • sodium channel, nonvoltage-gated 1, delta
  • voltage-gated, type I, delta polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74357
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
NBP1-84844
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22409
Species: Mu
Applications: WB, ICC/IF, IHC
NBP2-41371
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, S-ELISA, ELISA(Cap)
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30887
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-611
Species: Hu
Applications: WB, IP
NB300-188
Species: Rt
Applications: IHC, IHC-P
NBP2-24479
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP2-02521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-146
Species: Hu, Mu, Rt, Po, Bv, Ca, Dr, GP, Pm, Rb, Xp, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1555
Species: Hu
Applications: WB
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-76289
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, ICC
H00000480-R04
Species: Hu
NBP1-36975
Species: Ha(-)
Applications: ICC/IF, PEP-ELISA
AF482
Species: Mu
Applications: WB, IHC

Publications for SCNN1D Antibody (H00006339-M02) (0)

There are no publications for SCNN1D Antibody (H00006339-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCNN1D Antibody (H00006339-M02) (0)

There are no reviews for SCNN1D Antibody (H00006339-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SCNN1D Antibody (H00006339-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCNN1D Products

Bioinformatics Tool for SCNN1D Antibody (H00006339-M02)

Discover related pathways, diseases and genes to SCNN1D Antibody (H00006339-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCNN1D Antibody (H00006339-M02)

Discover more about diseases related to SCNN1D Antibody (H00006339-M02).
 

Pathways for SCNN1D Antibody (H00006339-M02)

View related products by pathway.

PTMs for SCNN1D Antibody (H00006339-M02)

Learn more about PTMs related to SCNN1D Antibody (H00006339-M02).

Blogs on SCNN1D

There are no specific blogs for SCNN1D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCNN1D Antibody (2F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol SCNN1D
Entrez
OMIM