SCN3A Antibody (2F8)

Images

 
There are currently no images for SCN3A Antibody (H00006328-M06).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SCN3A Antibody (2F8) Summary

Immunogen
SCN3A (NP_008853 1861 a.a. - 1960 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LCESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLKQRLKNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDG
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SCN3A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SCN3A Antibody (2F8)

  • brain III voltage-gated sodium channel
  • KIAA1356
  • NAC3
  • Nav1.3
  • Sodium channel protein brain III subunit alpha
  • sodium channel protein type 3 subunit alpha
  • Sodium channel protein type III subunit alpha
  • sodium channel, voltage-gated, type III, alpha polypeptide
  • sodium channel, voltage-gated, type III, alpha subunit
  • Voltage-gated sodium channel subtype III
  • Voltage-gated sodium channel subunit alpha Nav1.3

Background

SCN3A is a member of the sodium channel alpha subunit family and mediates the voltage-dependent sodium ion permeability of excitable membranes. It assumes an opened or closed conformation in response to voltage differences across the membrane; the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006326-Q01
Species: Hu
NBP2-58876
Species: Hu
Applications: ICC/IF
NBP2-12904
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
NBP1-47615
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
H00006334-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP1-82600
Species: Hu
Applications: IHC, IHC-P
H00006329-R01
Species: Hu
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
37470002
Species: Hu
Applications: WB, ELISA
NBP1-85816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-40840
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
AF6517
Species: Hu
Applications: WB
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-04663
Species: Hu
AF3565
Species: Mu
Applications: WB, IHC, IP
H00006328-M06
Species: Hu
Applications: WB, ELISA

Publications for SCN3A Antibody (H00006328-M06) (0)

There are no publications for SCN3A Antibody (H00006328-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCN3A Antibody (H00006328-M06) (0)

There are no reviews for SCN3A Antibody (H00006328-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCN3A Antibody (H00006328-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCN3A Products

Bioinformatics Tool for SCN3A Antibody (H00006328-M06)

Discover related pathways, diseases and genes to SCN3A Antibody (H00006328-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCN3A Antibody (H00006328-M06)

Discover more about diseases related to SCN3A Antibody (H00006328-M06).
 

Pathways for SCN3A Antibody (H00006328-M06)

View related products by pathway.

PTMs for SCN3A Antibody (H00006328-M06)

Learn more about PTMs related to SCN3A Antibody (H00006328-M06).

Blogs on SCN3A

There are no specific blogs for SCN3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCN3A Antibody (2F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol SCN3A
Uniprot