Schlafen 11 Antibody


Orthogonal Strategies: Western Blot: Schlafen 11 Antibody [NBP1-92368] - Analysis in human cell lines HEK293 and Caco-2 using anti-SLFN11 antibody. Corresponding SLFN11 RNA-seq data are presented for the same more
Immunocytochemistry/ Immunofluorescence: Schlafen 11 Antibody [NBP1-92368] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Schlafen 11 Antibody [NBP1-92368] - Staining of human pancreas shows moderate cytoplasmic positivity in islet cells.
Western Blot: Schlafen 11 Antibody [NBP1-92368] - Analysis in human cell line MOLT-4.
Simple Western: Schlafen 11 Antibody [NBP1-92368] - Simple Western lane view shows a specific band for SLFN11 in 0.2 mg/ml of MOLT-4 (left), HEK 239T (right) lysate. This experiment was performed under reducing more
Simple Western: Schlafen 11 Antibody [NBP1-92368] - Electropherogram image(s) of corresponding Simple Western lane view. Schlafen 8 antibody was used at 1:20 dilution on MOLT-4 and HEK 239T lysate(s).

Product Details

Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Schlafen 11 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: REVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIVDVLKRGELYGYACMIRVNPFCCAVFSEAPNSWI
Specificity of human Schlafen 11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Schlafen 11 Protein (NBP1-92368PEP)
Read Publications using NBP1-92368.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Schlafen 11 Antibody

  • FLJ34922
  • schlafen family member 11


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, Single Cell Western
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Schlafen 11 Antibody (NBP1-92368)(2)

Reviews for Schlafen 11 Antibody (NBP1-92368) (0)

There are no reviews for Schlafen 11 Antibody (NBP1-92368). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Schlafen 11 Antibody (NBP1-92368) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Schlafen 11 Antibody (NBP1-92368)

Discover related pathways, diseases and genes to Schlafen 11 Antibody (NBP1-92368). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Schlafen 11 Antibody (NBP1-92368)

Discover more about diseases related to Schlafen 11 Antibody (NBP1-92368).

Pathways for Schlafen 11 Antibody (NBP1-92368)

View related products by pathway.

Blogs on Schlafen 11

There are no specific blogs for Schlafen 11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Schlafen 11 Antibody and receive a gift card or discount.


Gene Symbol SLFN11