SLFN13 Antibody

Images

 
Immunohistochemistry-Paraffin: SLFN13 Antibody [NBP1-93880] - Staining of human pancreas shows strong cytoplasmic positivity in a subset of exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLFN13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YCRSGTSVLHMNSRQAFDFLKTKERQSKYNLINEGSPPSKIMKAVYQNISESNPAYEVFQTDTIEYGEILSFPESPSIE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLFN13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLFN13 Protein (NBP1-93880PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLFN13 Antibody

  • DKFZp666J196
  • DKFZp686I026
  • FLJ31952
  • schlafen family member 13
  • SLFN10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81178
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
7734-LF
Species: Hu
Applications: BA
AF4715
Species: Mu
Applications: WB
NBP2-82010
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-92368
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-70706
Species: Hu
Applications: WB
NBP1-93880
Species: Hu
Applications: IHC

Publications for SLFN13 Antibody (NBP1-93880) (0)

There are no publications for SLFN13 Antibody (NBP1-93880).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLFN13 Antibody (NBP1-93880) (0)

There are no reviews for SLFN13 Antibody (NBP1-93880). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLFN13 Antibody (NBP1-93880) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLFN13 Products

Diseases for SLFN13 Antibody (NBP1-93880)

Discover more about diseases related to SLFN13 Antibody (NBP1-93880).
 

Pathways for SLFN13 Antibody (NBP1-93880)

View related products by pathway.

Blogs on SLFN13

There are no specific blogs for SLFN13, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLFN13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLFN13