Recombinant Human SCEL Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SCEL Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 35462 of Human SCEL partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SNVTLRKMSPTGNEMKSTTQGTTRKQQDFHEVNKRRTFLQDNSWIKKRPEEEKDENYGRVVLNRHNSHDALDRKVNERDVPKATISRYSSDDTLDR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SCEL

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCEL Protein

  • FLJ21667
  • MGC22531
  • sciellin

Background

The protein encoded by this gene is a precursor to the cornified envelope of terminally differentiated keratinocytes. This protein localizes to the periphery of cells and may function in the assembly or regulation of proteins in the cornified envelope. Transcript variants encoding different isoforms exist. A transcript variant utilizing an alternative polyA signal has been described in the literature, but its full-length nature has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19775
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-54578
Species: Hu, Mu, Rt
Applications: WB, IHC-P, IP, PLA
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1339
Species: Hu
Applications: WB, Simple Western, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00006707-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-80687
Species: Hu
Applications: IHC, IHC-P
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NB100-55403
Species: Hu
Applications: WB, PEP-ELISA
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
H00023213-D01P
Species: Hu
Applications: WB, ELISA
H00008796-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SCEL Partial Recombinant Protein (H00008796-Q01) (0)

There are no publications for SCEL Partial Recombinant Protein (H00008796-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCEL Partial Recombinant Protein (H00008796-Q01) (0)

There are no reviews for SCEL Partial Recombinant Protein (H00008796-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCEL Partial Recombinant Protein (H00008796-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCEL Products

Bioinformatics Tool for SCEL Partial Recombinant Protein (H00008796-Q01)

Discover related pathways, diseases and genes to SCEL Partial Recombinant Protein (H00008796-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCEL Partial Recombinant Protein (H00008796-Q01)

Discover more about diseases related to SCEL Partial Recombinant Protein (H00008796-Q01).
 

Pathways for SCEL Partial Recombinant Protein (H00008796-Q01)

View related products by pathway.

Blogs on SCEL

There are no specific blogs for SCEL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SCEL Antibody
NBP1-82137

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCEL Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCEL