SART1 Recombinant Protein Antigen

Images

 
There are currently no images for SART1 Protein (NBP1-89023PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SART1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SART1.

Source: E. coli

Amino Acid Sequence: RRVKKIRKKEKEVVVRADDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVLEEDEAELELQKQLEKG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SART1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89023.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SART1 Recombinant Protein Antigen

  • Allergen Hom s 1
  • Ara1
  • HAF
  • HOMS1
  • hSART-1
  • hSnu66
  • hypoxia-associated factor
  • IgE Autoantigen
  • MGC2038
  • SART1
  • SART-1
  • SART1(259) protein
  • SART1(800) protein
  • SART1259
  • small nuclear ribonucleoprotein 110kDa (U4/U6.U5)
  • SNRNP110
  • SNU66 homolog
  • Snu66
  • squamous cell carcinoma antigen recognised by T cells
  • Squamous cell carcinoma antigen recognized by T cells 1
  • squamous cell carcinoma antigen recognized by T cells
  • U4/U6.U5 tri-snRNP-associated 110 kDa protein
  • U4/U6.U5 tri-snRNP-associated protein 1

Background

SART1, also known as hypoxia-associated factor (HAF), encodes two proteins, the SART1(800) protein expressed in the nucleus of the majority of proliferating cells, and the SART1(259) protein expressed in the cytosol of epithelial cancers. The SART1(259) protein is translated by the mechanism of -1 frameshifting during posttranscriptional regulation; its full-length sequence is not published yet. The two encoded proteins are thought to be involved in the regulation of proliferation. Both proteins have tumor-rejection antigens. The SART1(259) protein possesses tumor epitopes capable of inducing HLA-A2402-restricted cytotoxic T lymphocytes in cancer patients. This SART1(259) antigen may be useful in specific immunotherapy for cancer patients and may serve as a paradigmatic tool for the diagnosis and treatment of patients with atopy. The SART1(259) protein is found to be essential for the recruitment of the tri-snRNP to the pre-spliceosome in the spliceosome assembly pathway. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64775
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, Func, IHC, IHC-Fr, IHC-P (-), IP
NBP1-87962
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-74648
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP1-81853
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP3-20167
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IP, WB
NBP2-86885
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
202-IL
Species: Hu
Applications: BA
NBP3-16440
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
7954-GM/CF
Species: Hu
Applications: BA
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC,  IHC-P, WB
MAB2959
Species: Hu
Applications: ICC
NBP2-86470
Species: Hu
Applications: WB
NBP1-85358
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP1-89023PEP
Species: Hu
Applications: AC

Publications for SART1 Protein (NBP1-89023PEP) (0)

There are no publications for SART1 Protein (NBP1-89023PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SART1 Protein (NBP1-89023PEP) (0)

There are no reviews for SART1 Protein (NBP1-89023PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SART1 Protein (NBP1-89023PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SART1 Products

Research Areas for SART1 Protein (NBP1-89023PEP)

Find related products by research area.

Blogs on SART1

There are no specific blogs for SART1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SART1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SART1